BLASTX nr result
ID: Angelica27_contig00038854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038854 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237239.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 5e-34 XP_016561447.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 90 1e-18 XP_006338491.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 5e-18 XP_009795979.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 8e-17 XP_019229023.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 3e-16 XP_015066838.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_009602284.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 1e-14 XP_004232248.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 3e-14 KVI09141.1 Pentatricopeptide repeat-containing protein [Cynara c... 77 3e-14 XP_012841404.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 4e-13 XP_011098561.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 2e-12 XP_019183327.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 4e-11 XP_018719168.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 1e-09 XP_008230711.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 2e-09 ONI19351.1 hypothetical protein PRUPE_3G273600 [Prunus persica] 64 2e-09 KZV32929.1 pentatricopeptide repeat-containing protein chloropla... 63 3e-09 EYU34118.1 hypothetical protein MIMGU_mgv1a003395mg [Erythranthe... 62 1e-08 JAU35946.1 Pentatricopeptide repeat-containing protein, chloropl... 60 5e-08 XP_008379319.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 5e-08 XP_006431055.1 hypothetical protein CICLE_v10011224mg [Citrus cl... 60 5e-08 >XP_017237239.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Daucus carota subsp. sativus] XP_017237240.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Daucus carota subsp. sativus] XP_017237241.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Daucus carota subsp. sativus] XP_017237242.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Daucus carota subsp. sativus] XP_017237244.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Daucus carota subsp. sativus] KZN02415.1 hypothetical protein DCAR_011169 [Daucus carota subsp. sativus] Length = 662 Score = 133 bits (335), Expect = 5e-34 Identities = 65/72 (90%), Positives = 66/72 (91%) Frame = -3 Query: 217 IXSTSLSATHSSKHVWRKPTTPLPQSSHQPYRKRPHLGLLDHSIDMDELVTSIKQTTDEH 38 I +TSLSAT SSKHVWRKPT LPQSSHQPYRKRP LGLLDHSIDMDELV SIKQTTDEH Sbjct: 31 ISNTSLSATSSSKHVWRKPTNSLPQSSHQPYRKRPQLGLLDHSIDMDELVASIKQTTDEH 90 Query: 37 QLFALMSQYKTR 2 QLFALMSQYKTR Sbjct: 91 QLFALMSQYKTR 102 >XP_016561447.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Capsicum annuum] Length = 654 Score = 90.1 bits (222), Expect = 1e-18 Identities = 44/68 (64%), Positives = 50/68 (73%) Frame = -3 Query: 205 SLSATHSSKHVWRKPTTPLPQSSHQPYRKRPHLGLLDHSIDMDELVTSIKQTTDEHQLFA 26 SLSA+ SSK VWRK T P S HQPYR++ LDHS+DMD L+ SI QTT+EHQLFA Sbjct: 42 SLSASSSSKDVWRKTTPPFSPSRHQPYRRKHQSSYLDHSVDMDNLLYSIGQTTNEHQLFA 101 Query: 25 LMSQYKTR 2 LMS YK R Sbjct: 102 LMSPYKDR 109 >XP_006338491.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Solanum tuberosum] Length = 668 Score = 88.2 bits (217), Expect = 5e-18 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 1/69 (1%) Frame = -3 Query: 205 SLSATHSSKHVWRKPTTPLPQSSHQPYRKRPHLG-LLDHSIDMDELVTSIKQTTDEHQLF 29 SLSAT S+K VWRK T P S H+PYR+ P LDHS+DMD+L++SI QTT+EH+LF Sbjct: 45 SLSATSSTKDVWRKTTPPFSPSQHRPYRRNPQSNSFLDHSVDMDDLLSSIGQTTNEHELF 104 Query: 28 ALMSQYKTR 2 ALMS YK R Sbjct: 105 ALMSPYKGR 113 >XP_009795979.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Nicotiana sylvestris] XP_016508826.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Nicotiana tabacum] Length = 678 Score = 84.7 bits (208), Expect = 8e-17 Identities = 43/77 (55%), Positives = 54/77 (70%), Gaps = 9/77 (11%) Frame = -3 Query: 205 SLSATHSSKHVWRKPTTPLPQS---------SHQPYRKRPHLGLLDHSIDMDELVTSIKQ 53 SLSAT S+K VWRK TT P S H+PYR+R LDHS+DMD+L++SI+Q Sbjct: 45 SLSATSSNKDVWRKTTTTTPLSLKTPPFSSPHHRPYRRRQQSSHLDHSVDMDDLLSSIRQ 104 Query: 52 TTDEHQLFALMSQYKTR 2 TT+EH+LFALMS Y+ R Sbjct: 105 TTNEHELFALMSPYQNR 121 >XP_019229023.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Nicotiana attenuata] OIT30355.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 678 Score = 83.2 bits (204), Expect = 3e-16 Identities = 43/77 (55%), Positives = 52/77 (67%), Gaps = 9/77 (11%) Frame = -3 Query: 205 SLSATHSSKHVWRKPTTPLPQS---------SHQPYRKRPHLGLLDHSIDMDELVTSIKQ 53 SLSAT S+K VWRK TT P S H+PYR+R LDHS+DMD+L+ SI Q Sbjct: 45 SLSATSSNKDVWRKTTTATPSSLKTQPFSSPHHRPYRRRQQSSHLDHSVDMDDLLLSIGQ 104 Query: 52 TTDEHQLFALMSQYKTR 2 TT+EH+LFALMS Y+ R Sbjct: 105 TTNEHELFALMSPYQNR 121 >XP_015066838.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Solanum pennellii] Length = 666 Score = 81.3 bits (199), Expect = 1e-15 Identities = 42/69 (60%), Positives = 50/69 (72%), Gaps = 1/69 (1%) Frame = -3 Query: 205 SLSATHSSKHVWRKPTTPLPQSSHQPYRKRPHLG-LLDHSIDMDELVTSIKQTTDEHQLF 29 SLSAT K VWRK T P S H+PYR+ P LDHS+DMD+L++SI QTT+EH+LF Sbjct: 46 SLSAT---KDVWRKTTPPFSPSQHRPYRRNPQSNSFLDHSVDMDDLLSSIGQTTNEHELF 102 Query: 28 ALMSQYKTR 2 ALMS YK R Sbjct: 103 ALMSPYKGR 111 >XP_009602284.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Nicotiana tomentosiformis] XP_016497428.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Nicotiana tabacum] Length = 676 Score = 78.6 bits (192), Expect = 1e-14 Identities = 46/78 (58%), Positives = 55/78 (70%), Gaps = 10/78 (12%) Frame = -3 Query: 205 SLSATHSSKHVWRKP---TTPL-----PQSS--HQPYRKRPHLGLLDHSIDMDELVTSIK 56 SLSAT S+K VWRK TTPL P SS H+PYR+R LDHS+DMD+L+ SI Sbjct: 42 SLSATSSNKDVWRKTAATTTPLSLKTPPFSSPHHRPYRRRQQSLHLDHSVDMDDLLLSIG 101 Query: 55 QTTDEHQLFALMSQYKTR 2 QTT+EH+LFALMS Y+ R Sbjct: 102 QTTNEHELFALMSPYQNR 119 >XP_004232248.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Solanum lycopersicum] Length = 665 Score = 77.4 bits (189), Expect = 3e-14 Identities = 40/69 (57%), Positives = 49/69 (71%), Gaps = 1/69 (1%) Frame = -3 Query: 205 SLSATHSSKHVWRKPTTPLPQSSHQPYRKRPH-LGLLDHSIDMDELVTSIKQTTDEHQLF 29 SLSAT K VWRK T P S ++PYR+ P LDHS+DMD+L++SI QT +EH+LF Sbjct: 45 SLSAT---KDVWRKTTPPFSPSKYRPYRRNPQSTSFLDHSVDMDDLLSSIGQTANEHELF 101 Query: 28 ALMSQYKTR 2 ALMS YK R Sbjct: 102 ALMSPYKGR 110 >KVI09141.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 666 Score = 77.4 bits (189), Expect = 3e-14 Identities = 40/66 (60%), Positives = 51/66 (77%), Gaps = 4/66 (6%) Frame = -3 Query: 187 SSKHVWRK-PTTPL--PQSSH-QPYRKRPHLGLLDHSIDMDELVTSIKQTTDEHQLFALM 20 S+K +WRK P + + P SS QPYR+ P +G LDHS+DMDELV+SI QTT EH+LFAL+ Sbjct: 44 STKDIWRKTPKSRILRPSSSFPQPYRRNPEVGHLDHSVDMDELVSSINQTTSEHELFALL 103 Query: 19 SQYKTR 2 S YK+R Sbjct: 104 SPYKSR 109 >XP_012841404.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Erythranthe guttata] Length = 659 Score = 74.3 bits (181), Expect = 4e-13 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 3/72 (4%) Frame = -3 Query: 208 TSLSATHSSKHVWRKPTTPLPQSSHQP---YRKRPHLGLLDHSIDMDELVTSIKQTTDEH 38 T + + SK VWR+ TP+P P R++ +LG +DHS+DMDEL++SI QT+DEH Sbjct: 47 TIFALSSPSKDVWRRVHTPVPPIDTMPPQHLRRKHNLGFIDHSVDMDELLSSIGQTSDEH 106 Query: 37 QLFALMSQYKTR 2 +LFAL+S YK R Sbjct: 107 ELFALLSPYKCR 118 >XP_011098561.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Sesamum indicum] Length = 676 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/65 (50%), Positives = 48/65 (73%), Gaps = 4/65 (6%) Frame = -3 Query: 184 SKHVWRK----PTTPLPQSSHQPYRKRPHLGLLDHSIDMDELVTSIKQTTDEHQLFALMS 17 +K VWR+ P TP + HQP+R+ + LDHS+DM+EL++SI QT+DEH+L++LMS Sbjct: 56 AKDVWRRKTHVPLTPTNTTPHQPHRRNRNSAFLDHSVDMEELLSSIGQTSDEHELYSLMS 115 Query: 16 QYKTR 2 YK+R Sbjct: 116 LYKSR 120 >XP_019183327.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Ipomoea nil] Length = 670 Score = 68.6 bits (166), Expect = 4e-11 Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 4/72 (5%) Frame = -3 Query: 205 SLSATHSSKHVWRKPTTPLPQSSHQP----YRKRPHLGLLDHSIDMDELVTSIKQTTDEH 38 ++SAT SSK WR+ P P S P YR++ LD S+DM+EL+ SI +T++EH Sbjct: 43 AISATSSSKDAWRRTAEPPPPPSSSPRTTPYRRKQLPAFLDSSVDMEELLLSISKTSNEH 102 Query: 37 QLFALMSQYKTR 2 +LFALMS YK R Sbjct: 103 ELFALMSPYKGR 114 >XP_018719168.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic, partial [Eucalyptus grandis] Length = 660 Score = 64.3 bits (155), Expect = 1e-09 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 2/72 (2%) Frame = -3 Query: 211 STSLSATHSSKHVWRKPTTPLPQSSHQPYRKR--PHLGLLDHSIDMDELVTSIKQTTDEH 38 S S S++ +K VWR+ TP P+ +R+ PHL DHSIDMDELV+SI QT DE Sbjct: 38 SASSSSSAGNKDVWRR--TPQPRHRAPTFRRSESPHL---DHSIDMDELVSSISQTRDER 92 Query: 37 QLFALMSQYKTR 2 +LF+L+S YK R Sbjct: 93 ELFSLLSPYKGR 104 >XP_008230711.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Prunus mume] Length = 677 Score = 63.9 bits (154), Expect = 2e-09 Identities = 37/77 (48%), Positives = 49/77 (63%), Gaps = 9/77 (11%) Frame = -3 Query: 205 SLSATHSSKHVWRKP----TTPLPQSSHQPYRKRPHLGL-----LDHSIDMDELVTSIKQ 53 + SA+ ++KHVWR+ TTP SHQ +KR LDHSIDMDEL++SI Q Sbjct: 44 AFSASSTTKHVWRRTPQLKTTPSSSPSHQLTQKRHPRNQQGPSHLDHSIDMDELLSSIGQ 103 Query: 52 TTDEHQLFALMSQYKTR 2 T +E +L++LMS YK R Sbjct: 104 TQNEQELYSLMSTYKGR 120 >ONI19351.1 hypothetical protein PRUPE_3G273600 [Prunus persica] Length = 617 Score = 63.5 bits (153), Expect = 2e-09 Identities = 37/77 (48%), Positives = 49/77 (63%), Gaps = 9/77 (11%) Frame = -3 Query: 205 SLSATHSSKHVWRKP----TTPLPQSSHQPYRKRPHLGL-----LDHSIDMDELVTSIKQ 53 + SA+ ++KHVWR+ TTP SHQ +KR LDHSIDMDEL++SI Q Sbjct: 44 AFSASSTTKHVWRRTPQLKTTPSSPPSHQLTQKRHPRNQQGPSHLDHSIDMDELLSSIGQ 103 Query: 52 TTDEHQLFALMSQYKTR 2 T +E +L++LMS YK R Sbjct: 104 TQNEQELYSLMSTYKGR 120 >KZV32929.1 pentatricopeptide repeat-containing protein chloroplastic [Dorcoceras hygrometricum] Length = 672 Score = 63.2 bits (152), Expect = 3e-09 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 3/71 (4%) Frame = -3 Query: 205 SLSATHSS-KHVWRKPTTP--LPQSSHQPYRKRPHLGLLDHSIDMDELVTSIKQTTDEHQ 35 + S +HSS K VWR+ L ++ + +++ + LDH++DMDEL++SI QT+DEH+ Sbjct: 45 AFSPSHSSNKDVWRRQNAAQSLEETPRKFRKRKQNASFLDHNVDMDELLSSIGQTSDEHE 104 Query: 34 LFALMSQYKTR 2 L+ALMS YK R Sbjct: 105 LYALMSPYKDR 115 >EYU34118.1 hypothetical protein MIMGU_mgv1a003395mg [Erythranthe guttata] Length = 588 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -3 Query: 133 QPYRKRPHLGLLDHSIDMDELVTSIKQTTDEHQLFALMSQYKTR 2 Q R++ +LG +DHS+DMDEL++SI QT+DEH+LFAL+S YK R Sbjct: 4 QHLRRKHNLGFIDHSVDMDELLSSIGQTSDEHELFALLSPYKCR 47 >JAU35946.1 Pentatricopeptide repeat-containing protein, chloroplastic, partial [Noccaea caerulescens] Length = 479 Score = 59.7 bits (143), Expect = 5e-08 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = -3 Query: 208 TSLSATHSSKHVWRK-PTTPLPQSSHQPYRKRPHLGLLDHSIDMDELVTSIKQTTDEHQL 32 T ++ +K+VWRK P + P +H+ Y++ LDH +DMDEL+ SI QT +E +L Sbjct: 31 TPSPSSTQTKNVWRKQPESSTPSRNHRRYQRSV---FLDHKVDMDELLASIHQTQNEEEL 87 Query: 31 FALMSQYKTR 2 FAL+S YK R Sbjct: 88 FALLSLYKDR 97 >XP_008379319.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Malus domestica] Length = 677 Score = 59.7 bits (143), Expect = 5e-08 Identities = 36/74 (48%), Positives = 48/74 (64%), Gaps = 8/74 (10%) Frame = -3 Query: 199 SATHSSKHVWRKP----TTPLPQS--SHQPYRKRPHLGL--LDHSIDMDELVTSIKQTTD 44 S++ S++VWR+ T P P S SHQ R R G LDHS+DMDEL++SI QT + Sbjct: 47 SSSSPSRNVWRRTPQLKTXPSPSSTPSHQNRRPRNQQGPSHLDHSVDMDELLSSIGQTQN 106 Query: 43 EHQLFALMSQYKTR 2 E +L++LMS YK R Sbjct: 107 EQELYSLMSAYKGR 120 >XP_006431055.1 hypothetical protein CICLE_v10011224mg [Citrus clementina] ESR44295.1 hypothetical protein CICLE_v10011224mg [Citrus clementina] Length = 677 Score = 59.7 bits (143), Expect = 5e-08 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 1/71 (1%) Frame = -3 Query: 211 STSLSATHSSKHVWRKPTTPLPQSSHQPYRKRP-HLGLLDHSIDMDELVTSIKQTTDEHQ 35 S+S S+ SK +WR+ + P +K P HL DHS+DM+EL+ SI +T +EH+ Sbjct: 50 SSSSSSPSKSKDIWRRTPDKTTKYYRHPNKKVPVHL---DHSVDMNELLKSISETQNEHE 106 Query: 34 LFALMSQYKTR 2 LFAL+S YK R Sbjct: 107 LFALLSPYKDR 117