BLASTX nr result
ID: Angelica27_contig00038835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038835 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009232804.1 Ycf1 (chloroplast) [Angelica acutiloba] AMA97866.... 171 1e-47 ANS72160.1 Ycf1 (chloroplast) [Ledebouriella seseloides] 168 6e-47 YP_009186311.1 Ycf1 (chloroplast) [Ostericum grosseserratum] ALO... 168 9e-47 ANS72172.1 Ycf1 (chloroplast) [Ledebouriella seseloides] 168 9e-47 YP_009232974.1 Ycf1 (chloroplast) [Angelica gigas] AMA98037.1 Yc... 166 3e-46 YP_009331747.1 Ycf1 (chloroplast) [Arracacia xanthorrhiza] APH07... 166 6e-46 ANS72089.1 Ycf1 (chloroplast) [Glehnia littoralis] 165 8e-46 YP_009233058.1 Ycf1 (chloroplast) [Ligusticum tenuissimum] AMA98... 165 1e-45 YP_009155352.1 hypothetical chloroplast RF19 (plastid) [Seseli m... 164 2e-45 YP_009232889.1 Ycf1 (chloroplast) [Angelica dahurica] AMA97952.1... 164 4e-45 YP_009243623.1 hypothetical chloroplast RF1 (chloroplast) [Coria... 162 2e-44 YP_009338481.1 hypothetical protein RF1 (chloroplast) [Pterygopl... 161 3e-44 YP_009338399.1 hypothetical protein RF1 (chloroplast) [Peucedanu... 160 6e-44 YP_004222704.1 hypothetical chloroplast RF19 (chloroplast) [Anth... 159 2e-43 YP_009338314.1 hypothetical protein RF1 (chloroplast) [Pleurospe... 157 7e-43 YP_009155270.1 Ycf1 (plastid) [Pastinaca pimpinellifolia] AIU990... 156 1e-42 YP_009235938.1 hypothetical chloroplast RF1 (chloroplast) [Foeni... 154 8e-42 ADK90009.1 hypothetical chloroplast RF19 (chloroplast) [Petrosel... 151 1e-40 ADK89921.1 hypothetical chloroplast RF19 (chloroplast) [Crithmum... 150 1e-40 ADK89836.1 hypothetical chloroplast RF19 (chloroplast) [Tiedeman... 148 9e-40 >YP_009232804.1 Ycf1 (chloroplast) [Angelica acutiloba] AMA97866.1 Ycf1 (chloroplast) [Angelica acutiloba] Length = 1834 Score = 171 bits (432), Expect = 1e-47 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFFRNWMVKGSEFKDYTEEQKK Sbjct: 729 KFFFRNWMVKGSEFKDYTEEQKK 751 >ANS72160.1 Ycf1 (chloroplast) [Ledebouriella seseloides] Length = 759 Score = 168 bits (425), Expect = 6e-47 Identities = 82/83 (98%), Positives = 82/83 (98%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFFRNWM KGSEFKDYTEEQKK Sbjct: 729 KFFFRNWMGKGSEFKDYTEEQKK 751 >YP_009186311.1 Ycf1 (chloroplast) [Ostericum grosseserratum] ALO71656.1 Ycf1 (chloroplast) [Ostericum grosseserratum] Length = 1830 Score = 168 bits (425), Expect = 9e-47 Identities = 82/83 (98%), Positives = 82/83 (98%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFFRNWM KGSEFKDYTEEQKK Sbjct: 729 KFFFRNWMGKGSEFKDYTEEQKK 751 >ANS72172.1 Ycf1 (chloroplast) [Ledebouriella seseloides] Length = 1816 Score = 168 bits (425), Expect = 9e-47 Identities = 82/83 (98%), Positives = 82/83 (98%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFFRNWM KGSEFKDYTEEQKK Sbjct: 729 KFFFRNWMGKGSEFKDYTEEQKK 751 >YP_009232974.1 Ycf1 (chloroplast) [Angelica gigas] AMA98037.1 Ycf1 (chloroplast) [Angelica gigas] Length = 1830 Score = 166 bits (421), Expect = 3e-46 Identities = 81/83 (97%), Positives = 82/83 (98%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFFRNWM KGSEFKDYTE+QKK Sbjct: 729 KFFFRNWMGKGSEFKDYTEKQKK 751 >YP_009331747.1 Ycf1 (chloroplast) [Arracacia xanthorrhiza] APH07316.1 Ycf1 (chloroplast) [Arracacia xanthorrhiza] Length = 1830 Score = 166 bits (419), Expect = 6e-46 Identities = 81/83 (97%), Positives = 81/83 (97%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRRE IKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRRELIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFFRNWM KGSEFKDYTEEQKK Sbjct: 729 KFFFRNWMGKGSEFKDYTEEQKK 751 >ANS72089.1 Ycf1 (chloroplast) [Glehnia littoralis] Length = 1833 Score = 165 bits (418), Expect = 8e-46 Identities = 81/83 (97%), Positives = 81/83 (97%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFF NWM KGSEFKDYTEEQKK Sbjct: 729 KFFFLNWMGKGSEFKDYTEEQKK 751 >YP_009233058.1 Ycf1 (chloroplast) [Ligusticum tenuissimum] AMA98124.1 Ycf1 (chloroplast) [Ligusticum tenuissimum] Length = 1825 Score = 165 bits (417), Expect = 1e-45 Identities = 80/83 (96%), Positives = 81/83 (97%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 666 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 725 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 FFFRNWM KG+EFKDYTEEQKK Sbjct: 726 NFFFRNWMGKGAEFKDYTEEQKK 748 >YP_009155352.1 hypothetical chloroplast RF19 (plastid) [Seseli montanum] AIU99161.1 hypothetical chloroplast RF19 (plastid) [Seseli montanum] Length = 1830 Score = 164 bits (416), Expect = 2e-45 Identities = 80/83 (96%), Positives = 81/83 (97%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 FFFRNWM KGSEFKDYT+EQKK Sbjct: 729 NFFFRNWMGKGSEFKDYTKEQKK 751 >YP_009232889.1 Ycf1 (chloroplast) [Angelica dahurica] AMA97952.1 Ycf1 (chloroplast) [Angelica dahurica] Length = 1808 Score = 164 bits (414), Expect = 4e-45 Identities = 80/83 (96%), Positives = 81/83 (97%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQAN+HSPLFLDRIKKSPLFSFNIPEQM Sbjct: 647 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANSHSPLFLDRIKKSPLFSFNIPEQM 706 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFF NWM KGSEFKDYTEEQKK Sbjct: 707 KFFFINWMGKGSEFKDYTEEQKK 729 >YP_009243623.1 hypothetical chloroplast RF1 (chloroplast) [Coriandrum sativum] AKS03674.1 hypothetical chloroplast RF1 (chloroplast) [Coriandrum sativum] Length = 1832 Score = 162 bits (409), Expect = 2e-44 Identities = 81/85 (95%), Positives = 82/85 (96%), Gaps = 2/85 (2%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFK--DYTEEQKK 3 KFFFRNWM KG+EFK DYTEEQKK Sbjct: 729 KFFFRNWMGKGAEFKDYDYTEEQKK 753 >YP_009338481.1 hypothetical protein RF1 (chloroplast) [Pterygopleurum neurophyllum] ANK36576.1 hypothetical protein RF1 (chloroplast) [Pterygopleurum neurophyllum] Length = 1822 Score = 161 bits (407), Expect = 3e-44 Identities = 79/83 (95%), Positives = 79/83 (95%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKT IS LFQANAHSPLFLDRIKK PLFSFNIPEQM Sbjct: 660 SIRDYSEESDFRREFIKGSMRVQRRKTVISNLFQANAHSPLFLDRIKKYPLFSFNIPEQM 719 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFFRNWM KGSEFKDYTEEQKK Sbjct: 720 KFFFRNWMGKGSEFKDYTEEQKK 742 >YP_009338399.1 hypothetical protein RF1 (chloroplast) [Peucedanum insolens] ANK36494.1 hypothetical protein RF1 (chloroplast) [Peucedanum insolens] Length = 1838 Score = 160 bits (405), Expect = 6e-44 Identities = 78/83 (93%), Positives = 78/83 (93%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQAN HSPLFLDRIKKSP FSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANVHSPLFLDRIKKSPFFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KF FRNWM KGSE KDYTEEQKK Sbjct: 729 KFLFRNWMGKGSELKDYTEEQKK 751 >YP_004222704.1 hypothetical chloroplast RF19 (chloroplast) [Anthriscus cerefolium] ADD13696.1 hypothetical chloroplast RF19 (chloroplast) [Anthriscus cerefolium] Length = 1793 Score = 159 bits (401), Expect = 2e-43 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIR+YSEESDFRREFIKGSMRVQRRKTFISKLFQAN HSPLFLDRIK SP+FSFNIPEQM Sbjct: 663 SIREYSEESDFRREFIKGSMRVQRRKTFISKLFQANLHSPLFLDRIKNSPIFSFNIPEQM 722 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFFRNWM K SEFKDYTEEQKK Sbjct: 723 KFFFRNWMGKRSEFKDYTEEQKK 745 >YP_009338314.1 hypothetical protein RF1 (chloroplast) [Pleurospermum camtschaticum] ANK36409.1 hypothetical protein RF1 (chloroplast) [Pleurospermum camtschaticum] Length = 1804 Score = 157 bits (397), Expect = 7e-43 Identities = 76/83 (91%), Positives = 78/83 (93%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMR QRRKT ISKLFQANAHSP+FLDRIKKSPLFSFNIPEQM Sbjct: 663 SIRDYSEESDFRREFIKGSMRAQRRKTVISKLFQANAHSPIFLDRIKKSPLFSFNIPEQM 722 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KF FRNWM KG+EFKDY EEQKK Sbjct: 723 KFIFRNWMGKGAEFKDYKEEQKK 745 >YP_009155270.1 Ycf1 (plastid) [Pastinaca pimpinellifolia] AIU99079.1 Ycf1 (plastid) [Pastinaca pimpinellifolia] Length = 1828 Score = 156 bits (395), Expect = 1e-42 Identities = 77/83 (92%), Positives = 78/83 (93%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQAN HSPLFLDRIKK PLFSFNIPEQM Sbjct: 669 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANVHSPLFLDRIKKYPLFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KFFF NWM K +EFKDYTEEQKK Sbjct: 729 KFFFINWMGKVAEFKDYTEEQKK 751 >YP_009235938.1 hypothetical chloroplast RF1 (chloroplast) [Foeniculum vulgare] AMD83974.1 hypothetical chloroplast RF1 (chloroplast) [Foeniculum vulgare] Length = 1817 Score = 154 bits (389), Expect = 8e-42 Identities = 75/83 (90%), Positives = 77/83 (92%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYS+ESDFRREFIKGSMR QRRKT ISKLFQANAHSPLFLDRIKKSP FSFNIPEQM Sbjct: 669 SIRDYSDESDFRREFIKGSMRGQRRKTVISKLFQANAHSPLFLDRIKKSPFFSFNIPEQM 728 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 K FRNWM KG+EFKDYTEEQKK Sbjct: 729 KLIFRNWMGKGAEFKDYTEEQKK 751 >ADK90009.1 hypothetical chloroplast RF19 (chloroplast) [Petroselinum crispum] Length = 1822 Score = 151 bits (381), Expect = 1e-40 Identities = 76/85 (89%), Positives = 78/85 (91%), Gaps = 2/85 (2%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIRDYS+ESDFRREFIKGSMRVQRRKT ISKLFQANAHSPLFLDRIKKSP FSFNIPEQM Sbjct: 669 SIRDYSDESDFRREFIKGSMRVQRRKTVISKLFQANAHSPLFLDRIKKSPFFSFNIPEQM 728 Query: 71 KFFF--RNWMVKGSEFKDYTEEQKK 3 KF F RNWM K +EFKDYTEEQKK Sbjct: 729 KFIFRNRNWMGKRAEFKDYTEEQKK 753 >ADK89921.1 hypothetical chloroplast RF19 (chloroplast) [Crithmum maritimum] Length = 1825 Score = 150 bits (380), Expect = 1e-40 Identities = 75/83 (90%), Positives = 76/83 (91%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SI+DYSEESDFRREFIKGSMRVQRRKT ISKLFQAN HSPLFLDRIKKSPLFSFNIPEQM Sbjct: 672 SIKDYSEESDFRREFIKGSMRVQRRKTVISKLFQANVHSPLFLDRIKKSPLFSFNIPEQM 731 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 KF FRN M KG EFKDY EEQKK Sbjct: 732 KFIFRNLMGKGVEFKDYKEEQKK 754 >ADK89836.1 hypothetical chloroplast RF19 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] Length = 1816 Score = 148 bits (374), Expect = 9e-40 Identities = 72/83 (86%), Positives = 76/83 (91%) Frame = -3 Query: 251 SIRDYSEESDFRREFIKGSMRVQRRKTFISKLFQANAHSPLFLDRIKKSPLFSFNIPEQM 72 SIR+YSEESDFRRE I+GSMRVQRRKT ISKLFQAN HSPLFLDRIKKSPLFSFNIPEQ+ Sbjct: 675 SIREYSEESDFRRELIRGSMRVQRRKTVISKLFQANVHSPLFLDRIKKSPLFSFNIPEQI 734 Query: 71 KFFFRNWMVKGSEFKDYTEEQKK 3 K+ F NWM KG EFKDYTEEQKK Sbjct: 735 KYIFINWMGKGVEFKDYTEEQKK 757