BLASTX nr result
ID: Angelica27_contig00038712
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038712 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ADA59312.1 AtpI, partial (chloroplast) [Oryza neocaledonica] 65 6e-12 ADA59298.1 AtpI, partial (chloroplast) [Oryza rufipogon] ADA5929... 65 6e-12 ABI14661.1 ATP synthase CF0 subunit, partial [Aegiceras cornicul... 65 6e-12 AGL75846.1 ATP synthase CF0 A subunit, partial (chloroplast) [Ab... 65 7e-12 BAU22214.1 ATP synthase CF0 A subunit, partial (chloroplast) [To... 65 8e-12 BAU22215.1 ATP synthase CF0 A subunit, partial (chloroplast) [To... 65 8e-12 CDY21189.1 BnaA01g34200D [Brassica napus] 65 9e-12 AGL75838.1 ATP synthase CF0 A subunit, partial (chloroplast) [Ab... 65 1e-11 KQK91810.1 hypothetical protein SETIT_038243mg [Setaria italica] 65 1e-11 AKC42357.1 ATP synthase CF0 A chain, partial (chloroplast) [Holo... 63 3e-11 AGL75841.1 ATP synthase CF0 A subunit, partial (chloroplast) [Ab... 65 3e-11 AGL75820.1 ATP synthase CF0 A subunit, partial (chloroplast) [Ab... 65 3e-11 AGL75795.1 ATP synthase CF0 A subunit, partial (chloroplast) [Ab... 65 3e-11 ADA59314.1 AtpI, partial (chloroplast) [Leersia perrieri] 63 3e-11 KJB75108.1 hypothetical protein B456_012G024800 [Gossypium raimo... 64 4e-11 XP_013442561.1 ATP synthase subunit A [Medicago truncatula] KEH1... 65 4e-11 AFN85350.1 ATP synthase CF0 subunit IV, partial (chloroplast) [A... 65 5e-11 AFN85358.1 ATP synthase CF0 subunit IV, partial (chloroplast) [E... 65 5e-11 AFN85351.1 ATP synthase CF0 subunit IV, partial (chloroplast) [B... 65 5e-11 AFN85349.1 ATP synthase CF0 subunit IV, partial (chloroplast) [A... 65 5e-11 >ADA59312.1 AtpI, partial (chloroplast) [Oryza neocaledonica] Length = 34 Score = 64.7 bits (156), Expect = 6e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 279 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 MFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 4 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 34 >ADA59298.1 AtpI, partial (chloroplast) [Oryza rufipogon] ADA59299.1 AtpI, partial (chloroplast) [Oryza glaberrima] ADA59300.1 AtpI, partial (chloroplast) [Oryza meridionalis] ADA59301.1 AtpI, partial (chloroplast) [Oryza punctata] ADA59302.1 AtpI, partial (chloroplast) [Oryza malampuzhaensis] ADA59303.1 AtpI, partial (chloroplast) [Oryza officinalis] ADA59304.1 AtpI, partial (chloroplast) [Oryza punctata] ADA59305.1 AtpI, partial (chloroplast) [Oryza rhizomatis] ADA59306.1 AtpI, partial (chloroplast) [Oryza latifolia] ADA59307.1 AtpI, partial (chloroplast) [Oryza australiensis] ADA59308.1 AtpI, partial (chloroplast) [Oryza coarctata] ADA59309.1 AtpI, partial (chloroplast) [Oryza brachyantha] ADA59310.1 AtpI, partial (chloroplast) [Oryza ridleyi] ADA59311.1 AtpI, partial (chloroplast) [Oryza meyeriana var. granulata] ADA59313.1 AtpI, partial (chloroplast) [Leersia oryzoides] ADA59315.1 AtpI, partial (chloroplast) [Leersia hexandra] ADA59316.1 AtpI, partial (chloroplast) [Leersia tisserantii] ADA59317.1 AtpI, partial (chloroplast) [Maltebrunia letestui] ADA59318.1 AtpI, partial (chloroplast) [Prosphytochloa prehensilis] ADA59319.1 AtpI, partial (chloroplast) [Potamophila parviflora] ADA59320.1 AtpI, partial (chloroplast) [Chikusichloa aquatica] ADA59321.1 AtpI, partial (chloroplast) [Chikusichloa mutica] ADA59322.1 AtpI, partial (chloroplast) [Zizania aquatica] ADA59323.1 AtpI, partial (chloroplast) [Zizania latifolia] ADA59324.1 AtpI, partial (chloroplast) [Rhynchoryza subulata] ADA59325.1 AtpI, partial (chloroplast) [Luziola fluitans] ADA59326.1 AtpI, partial (chloroplast) [Luziola fluitans] ADA59327.1 AtpI, partial (chloroplast) [Zizaniopsis villanensis] ADA59328.1 AtpI, partial (chloroplast) [Hygroryza aristata] ADA59329.1 AtpI, partial (chloroplast) [Ehrharta erecta] ADA59330.1 AtpI, partial (chloroplast) [Phyllostachys aurea] Length = 35 Score = 64.7 bits (156), Expect = 6e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 279 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 MFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 5 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 35 >ABI14661.1 ATP synthase CF0 subunit, partial [Aegiceras corniculatum] Length = 39 Score = 64.7 bits (156), Expect = 6e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 279 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 MFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 9 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 39 >AGL75846.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies bracteata] Length = 45 Score = 64.7 bits (156), Expect = 7e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 279 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 MFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 15 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 45 >BAU22214.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22216.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22218.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22222.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22225.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22227.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22230.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] Length = 64 Score = 65.1 bits (157), Expect = 8e-12 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 12 LADELVVVVLVSLVPLVIPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 64 >BAU22215.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22217.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22219.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22220.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22221.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22223.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22224.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22226.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22228.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22229.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] Length = 65 Score = 65.1 bits (157), Expect = 8e-12 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 13 LADELVVVVLVSLVPLVIPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 65 >CDY21189.1 BnaA01g34200D [Brassica napus] Length = 57 Score = 64.7 bits (156), Expect = 9e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 279 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 MFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 27 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 57 >AGL75838.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies grandis] Length = 88 Score = 65.1 bits (157), Expect = 1e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 36 LADELVVAVPVSPVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 88 >KQK91810.1 hypothetical protein SETIT_038243mg [Setaria italica] Length = 90 Score = 65.1 bits (157), Expect = 1e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 38 LADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 90 >AKC42357.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42358.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42359.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42360.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42361.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42362.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42363.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42364.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42365.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42366.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42367.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42368.1 ATP synthase CF0 A chain, partial (chloroplast) [Hololachna songarica] AKC42369.1 ATP synthase CF0 A chain, partial (chloroplast) [Myricaria pulcherrima] AKC42370.1 ATP synthase CF0 A chain, partial (chloroplast) [Tamarix amplexicaulis] AKC42371.1 ATP synthase CF0 A chain, partial (chloroplast) [Tamarix amplexicaulis] Length = 30 Score = 62.8 bits (151), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 276 FLGLFTSGIQALIFATLAAAYIGESMEGHH 187 FLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 1 FLGLFTSGIQALIFATLAAAYIGESMEGHH 30 >AGL75841.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies durangensis] Length = 121 Score = 65.1 bits (157), Expect = 3e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 69 LADELVVAVPVSPVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 121 >AGL75820.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies lasiocarpa] AGL75821.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies lasiocarpa] AGL75822.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies balsamea] AGL75823.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies balsamea] AGL75824.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies fraseri] AGL75825.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies balsamea var. phanerolepis] Length = 121 Score = 65.1 bits (157), Expect = 3e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 69 LADELVVAVPVSPVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 121 >AGL75795.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sibirica] AGL75796.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sibirica] AGL75797.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sibirica subsp. semenovii] AGL75798.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sibirica subsp. semenovii] AGL75799.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies nephrolepis] AGL75800.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies nephrolepis] AGL75801.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sachalinensis] AGL75802.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sachalinensis] AGL75803.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sachalinensis var. gracilis] AGL75804.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sachalinensis var. gracilis] AGL75805.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies koreana] AGL75806.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies veitchii] AGL75807.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies veitchii] AGL75808.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies chensiensis] AGL75809.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies holophylla] AGL75810.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies homolepis] AGL75811.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies homolepis] AGL75812.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies firma] AGL75813.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies firma] AGL75814.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies spectabilis] AGL75815.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies densa] AGL75816.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies squamata] AGL75817.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies recurvata] AGL75818.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies delavayi] AGL75819.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies forrestii] AGL75826.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies alba] AGL75827.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies alba] AGL75828.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies nordmanniana] AGL75829.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies cephalonica] AGL75830.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies numidica] AGL75831.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies cilicica] AGL75832.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies pinsapo] AGL75833.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies pinsapo] AGL75834.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies nordmanniana subsp. equi-trojani] AGL75835.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies magnifica] AGL75836.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies magnifica] AGL75837.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies grandis] AGL75839.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies concolor] AGL75840.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies concolor] AGL75842.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies religiosa] AGL75843.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies guatemalensis] AGL75844.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies vejarii] AGL75845.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies bracteata] Length = 121 Score = 65.1 bits (157), Expect = 3e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 69 LADELVVAVPVSPVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 121 >ADA59314.1 AtpI, partial (chloroplast) [Leersia perrieri] Length = 35 Score = 62.8 bits (151), Expect = 3e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 279 MFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 MFLGLFTSGIQALIFATLAA YIGESMEGHH Sbjct: 5 MFLGLFTSGIQALIFATLAAPYIGESMEGHH 35 >KJB75108.1 hypothetical protein B456_012G024800 [Gossypium raimondii] Length = 71 Score = 63.5 bits (153), Expect = 4e-11 Identities = 35/53 (66%), Positives = 35/53 (66%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLA AYIGESMEGHH Sbjct: 19 LADELVVVVIVSLVPSVVPILVMFLGLFTSGIQALIFATLAVAYIGESMEGHH 71 >XP_013442561.1 ATP synthase subunit A [Medicago truncatula] KEH16586.1 ATP synthase subunit A [Medicago truncatula] Length = 132 Score = 65.1 bits (157), Expect = 4e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 80 LADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 132 >AFN85350.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Aerangis hyaloides] Length = 140 Score = 65.1 bits (157), Expect = 5e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 88 LADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 140 >AFN85358.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Eria corneri] Length = 142 Score = 65.1 bits (157), Expect = 5e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 90 LADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 142 >AFN85351.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Bletilla formosana] AFN85352.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Calanthe alismifolia] AFN85353.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Calanthe discolor] AFN85354.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Calanthe rosea] AFN85355.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Calanthe sylvatica] AFN85356.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Cymbidium aloifolium] AFN85359.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Phaius takeoi] AFN85360.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Spathoglottis plicata] Length = 142 Score = 65.1 bits (157), Expect = 5e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 90 LADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 142 >AFN85349.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Acampe rigida] AFN85357.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Dendrobium equitans] Length = 142 Score = 65.1 bits (157), Expect = 5e-11 Identities = 36/53 (67%), Positives = 36/53 (67%) Frame = -2 Query: 345 LADEXXXXXXXXXXXXXXXXXVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 187 LADE VMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 90 LADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 142