BLASTX nr result
ID: Angelica27_contig00038629
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038629 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011026709.1 PREDICTED: cytochrome c oxidase assembly protein ... 60 4e-09 XP_006432691.1 hypothetical protein CICLE_v100021202mg, partial ... 58 4e-09 XP_006432693.1 hypothetical protein CICLE_v100021202mg, partial ... 58 4e-09 XP_002297920.2 hypothetical protein POPTR_0001s11910g [Populus t... 60 6e-09 XP_006432692.1 hypothetical protein CICLE_v100021202mg, partial ... 58 7e-09 XP_020081471.1 cytochrome c oxidase assembly protein COX11, mito... 58 1e-08 KRG97988.1 hypothetical protein GLYMA_18G043100 [Glycine max] 59 1e-08 XP_016548106.1 PREDICTED: cytochrome c oxidase assembly protein ... 59 1e-08 OIV95706.1 hypothetical protein TanjilG_01500 [Lupinus angustifo... 59 1e-08 EPS69466.1 hypothetical protein M569_05299, partial [Genlisea au... 58 2e-08 KVH69086.1 cytochrome c oxidase assembly protein CtaG/Cox11 [Cyn... 59 2e-08 XP_010274440.1 PREDICTED: cytochrome c oxidase assembly protein ... 58 2e-08 KHN24158.1 Cytochrome c oxidase assembly protein COX11, mitochon... 58 2e-08 XP_016501025.1 PREDICTED: cytochrome c oxidase assembly protein ... 59 2e-08 XP_009780093.1 PREDICTED: cytochrome c oxidase assembly protein ... 59 2e-08 XP_009595498.1 PREDICTED: cytochrome c oxidase assembly protein ... 58 2e-08 XP_020099458.1 cytochrome c oxidase assembly protein COX11, mito... 58 2e-08 XP_018719954.1 PREDICTED: cytochrome c oxidase assembly protein ... 58 2e-08 EEF34242.1 cytochrome C oxidase assembly protein cox11, putative... 58 3e-08 XP_013459875.1 cytochrome C oxidase assembly protein CtaG/COX11 ... 58 3e-08 >XP_011026709.1 PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Populus euphratica] Length = 204 Score = 60.1 bits (144), Expect = 4e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKMMCL 141 PGES LAFYTA+N SSTPITG+STYNVTPMK++ L Sbjct: 160 PGESALAFYTAENQSSTPITGVSTYNVTPMKVLIL 194 >XP_006432691.1 hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] ESR45931.1 hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] Length = 95 Score = 57.8 bits (138), Expect = 4e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMK 153 PGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 29 PGESALAFYTAENRSSTPITGVSTYNVTPMK 59 >XP_006432693.1 hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] ESR45933.1 hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] Length = 96 Score = 57.8 bits (138), Expect = 4e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMK 153 PGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 29 PGESALAFYTAENRSSTPITGVSTYNVTPMK 59 >XP_002297920.2 hypothetical protein POPTR_0001s11910g [Populus trichocarpa] EEE82725.2 hypothetical protein POPTR_0001s11910g [Populus trichocarpa] Length = 215 Score = 59.7 bits (143), Expect = 6e-09 Identities = 33/48 (68%), Positives = 37/48 (77%), Gaps = 3/48 (6%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKMMCL---SKRAEHASNR 111 PGES LAFYTA+N SSTPITG+STYNVTPMK CL ++R SNR Sbjct: 160 PGESALAFYTAENRSSTPITGVSTYNVTPMK-TCLDFGNQRISSQSNR 206 >XP_006432692.1 hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] ESR45932.1 hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] Length = 119 Score = 57.8 bits (138), Expect = 7e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMK 153 PGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 29 PGESALAFYTAENRSSTPITGVSTYNVTPMK 59 >XP_020081471.1 cytochrome c oxidase assembly protein COX11, mitochondrial-like [Ananas comosus] Length = 157 Score = 58.2 bits (139), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKM 150 PGES LAFYTA+N SSTPITG+STYNVTPMK+ Sbjct: 76 PGESALAFYTAENLSSTPITGVSTYNVTPMKV 107 >KRG97988.1 hypothetical protein GLYMA_18G043100 [Glycine max] Length = 229 Score = 58.9 bits (141), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKMM 147 PGES LAFYTA+N SSTPITG+STYNVTPMK++ Sbjct: 194 PGESALAFYTAENKSSTPITGVSTYNVTPMKVL 226 >XP_016548106.1 PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Capsicum annuum] Length = 231 Score = 58.9 bits (141), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKMM 147 PGES LAFYTA+N SSTPITG+STYNVTPMK++ Sbjct: 197 PGESALAFYTAENRSSTPITGVSTYNVTPMKLI 229 >OIV95706.1 hypothetical protein TanjilG_01500 [Lupinus angustifolius] Length = 232 Score = 58.9 bits (141), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKMM 147 PGES LAFYTA+N SSTPITG+STYNVTPMK++ Sbjct: 194 PGESALAFYTAENKSSTPITGVSTYNVTPMKIL 226 >EPS69466.1 hypothetical protein M569_05299, partial [Genlisea aurea] Length = 164 Score = 57.8 bits (138), Expect = 2e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMK 153 PGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 106 PGESALAFYTAENLSSTPITGVSTYNVTPMK 136 >KVH69086.1 cytochrome c oxidase assembly protein CtaG/Cox11 [Cynara cardunculus var. scolymus] Length = 312 Score = 59.3 bits (142), Expect = 2e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMK 153 PGES LAFYTA+N SSTPITGMSTYNVTPMK Sbjct: 168 PGESALAFYTAENRSSTPITGMSTYNVTPMK 198 >XP_010274440.1 PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Nelumbo nucifera] Length = 166 Score = 57.8 bits (138), Expect = 2e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMK 153 PGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 76 PGESALAFYTAENRSSTPITGVSTYNVTPMK 106 >KHN24158.1 Cytochrome c oxidase assembly protein COX11, mitochondrial [Glycine soja] Length = 177 Score = 57.8 bits (138), Expect = 2e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMK 153 PGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 87 PGESALAFYTAENKSSTPITGVSTYNVTPMK 117 >XP_016501025.1 PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like isoform X2 [Nicotiana tabacum] Length = 243 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKM 150 PGES LAFYTA+N SSTPITG+STYNVTPMK+ Sbjct: 197 PGESALAFYTAENRSSTPITGVSTYNVTPMKL 228 >XP_009780093.1 PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Nicotiana sylvestris] Length = 243 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKM 150 PGES LAFYTA+N SSTPITG+STYNVTPMK+ Sbjct: 197 PGESALAFYTAENRSSTPITGVSTYNVTPMKL 228 >XP_009595498.1 PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X3 [Nicotiana tomentosiformis] XP_016476480.1 PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Nicotiana tabacum] Length = 185 Score = 57.8 bits (138), Expect = 2e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMK 153 PGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 95 PGESALAFYTAENRSSTPITGVSTYNVTPMK 125 >XP_020099458.1 cytochrome c oxidase assembly protein COX11, mitochondrial-like isoform X2 [Ananas comosus] Length = 227 Score = 58.2 bits (139), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKM 150 PGES LAFYTA+N SSTPITG+STYNVTPMK+ Sbjct: 164 PGESALAFYTAENLSSTPITGVSTYNVTPMKV 195 >XP_018719954.1 PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Eucalyptus grandis] Length = 197 Score = 57.8 bits (138), Expect = 2e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMK 153 PGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 107 PGESALAFYTAENRSSTPITGVSTYNVTPMK 137 >EEF34242.1 cytochrome C oxidase assembly protein cox11, putative [Ricinus communis] Length = 199 Score = 57.8 bits (138), Expect = 3e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKMMCLSKR 132 PGES LAFYTA+N S TPITG+STYNVTPMK+ L R Sbjct: 160 PGESALAFYTAENRSKTPITGVSTYNVTPMKINFLVSR 197 >XP_013459875.1 cytochrome C oxidase assembly protein CtaG/COX11 [Medicago truncatula] KEH33906.1 cytochrome C oxidase assembly protein CtaG/COX11 [Medicago truncatula] Length = 230 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 245 PGESELAFYTAKN*SSTPITGMSTYNVTPMKM 150 PGES LAFYTA+N SSTPITG+STYNVTPMK+ Sbjct: 195 PGESALAFYTAENQSSTPITGVSTYNVTPMKV 226