BLASTX nr result
ID: Angelica27_contig00037376
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00037376 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN00004.1 hypothetical protein DCAR_008758 [Daucus carota subsp... 66 5e-11 KZM89575.1 hypothetical protein DCAR_023062 [Daucus carota subsp... 66 5e-11 XP_017254297.1 PREDICTED: APO protein 4, mitochondrial-like [Dau... 66 6e-11 XP_017241942.1 PREDICTED: APO protein 4, mitochondrial-like [Dau... 66 6e-11 KVI00400.1 APO domain-containing protein [Cynara cardunculus var... 54 1e-06 >KZN00004.1 hypothetical protein DCAR_008758 [Daucus carota subsp. sativus] Length = 314 Score = 66.2 bits (160), Expect = 5e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 145 DYPIKAMILVAEDVLKARILLIQGVATLHQFVPLWTC 35 DYPIKAMI VAEDVLKAR+LLIQGV+TL FVP+WTC Sbjct: 29 DYPIKAMIPVAEDVLKARVLLIQGVSTLLNFVPVWTC 65 >KZM89575.1 hypothetical protein DCAR_023062 [Daucus carota subsp. sativus] Length = 314 Score = 66.2 bits (160), Expect = 5e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 145 DYPIKAMILVAEDVLKARILLIQGVATLHQFVPLWTC 35 DYPIKAMI VAEDVLKAR+LLIQGV+TL FVP+WTC Sbjct: 29 DYPIKAMIPVAEDVLKARVLLIQGVSTLLNFVPVWTC 65 >XP_017254297.1 PREDICTED: APO protein 4, mitochondrial-like [Daucus carota subsp. sativus] Length = 344 Score = 66.2 bits (160), Expect = 6e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 145 DYPIKAMILVAEDVLKARILLIQGVATLHQFVPLWTC 35 DYPIKAMI VAEDVLKAR+LLIQGV+TL FVP+WTC Sbjct: 59 DYPIKAMIPVAEDVLKARVLLIQGVSTLLNFVPVWTC 95 >XP_017241942.1 PREDICTED: APO protein 4, mitochondrial-like [Daucus carota subsp. sativus] Length = 344 Score = 66.2 bits (160), Expect = 6e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 145 DYPIKAMILVAEDVLKARILLIQGVATLHQFVPLWTC 35 DYPIKAMI VAEDVLKAR+LLIQGV+TL FVP+WTC Sbjct: 59 DYPIKAMIPVAEDVLKARVLLIQGVSTLLNFVPVWTC 95 >KVI00400.1 APO domain-containing protein [Cynara cardunculus var. scolymus] Length = 303 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -3 Query: 145 DYPIKAMILVAEDVLKARILLIQGVATLHQFVPLWTC 35 DYP+KAM+ VA DVL++R LLIQGV+ L Q +P+W+C Sbjct: 48 DYPVKAMVPVAYDVLRSRTLLIQGVSILLQVIPIWSC 84