BLASTX nr result
ID: Angelica27_contig00037304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00037304 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255733.1 PREDICTED: leucine-rich repeat receptor-like seri... 62 2e-09 XP_016560560.1 PREDICTED: probable LRR receptor-like serine/thre... 55 7e-07 XP_006340694.1 PREDICTED: probably inactive leucine-rich repeat ... 54 1e-06 XP_015063501.1 PREDICTED: probable LRR receptor-like serine/thre... 54 1e-06 XP_004232455.1 PREDICTED: probable LRR receptor-like serine/thre... 54 1e-06 XP_016475421.1 PREDICTED: probable LRR receptor-like serine/thre... 54 2e-06 XP_009798456.1 PREDICTED: probable LRR receptor-like serine/thre... 54 2e-06 XP_016481630.1 PREDICTED: leucine-rich repeat receptor-like prot... 53 3e-06 XP_009605875.1 PREDICTED: LRR receptor-like serine/threonine-pro... 53 3e-06 >XP_017255733.1 PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 [Daucus carota subsp. sativus] KZM91147.1 hypothetical protein DCAR_021488 [Daucus carota subsp. sativus] Length = 420 Score = 62.0 bits (149), Expect = 2e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 93 QVHSITHWQDIQVLEDFKNAVSPNSASPGSC 1 Q HS+THW+DI+VLEDFKNAV+PNS SPGSC Sbjct: 21 QAHSVTHWEDIRVLEDFKNAVTPNSVSPGSC 51 >XP_016560560.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase IRK [Capsicum annuum] Length = 420 Score = 54.7 bits (130), Expect = 7e-07 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = -3 Query: 111 IFISVLQVHSITHWQDIQVLEDFKNAVSPNSASPGSC 1 ++ L HS THWQDIQVL+ KN+V PNS +PGSC Sbjct: 15 LYTQFLHAHSTTHWQDIQVLKQLKNSVDPNSITPGSC 51 >XP_006340694.1 PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Solanum tuberosum] Length = 420 Score = 54.3 bits (129), Expect = 1e-06 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = -3 Query: 111 IFISVLQVHSITHWQDIQVLEDFKNAVSPNSASPGSC 1 ++ L HS THWQDI+VL+ KN+V PNS SPGSC Sbjct: 15 LYALFLHAHSTTHWQDIEVLKQLKNSVDPNSVSPGSC 51 >XP_015063501.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180 [Solanum pennellii] Length = 415 Score = 53.9 bits (128), Expect = 1e-06 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = -3 Query: 111 IFISVLQVHSITHWQDIQVLEDFKNAVSPNSASPGSC 1 ++ L HS THWQDI+VL+ KN+V PNS SPGSC Sbjct: 10 LYALFLHAHSTTHWQDIEVLKQLKNSVDPNSMSPGSC 46 >XP_004232455.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180 [Solanum lycopersicum] Length = 415 Score = 53.9 bits (128), Expect = 1e-06 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = -3 Query: 111 IFISVLQVHSITHWQDIQVLEDFKNAVSPNSASPGSC 1 ++ L HS THWQDI+VL+ KN+V PNS SPGSC Sbjct: 10 LYALFLHAHSTTHWQDIEVLKQLKNSVDPNSMSPGSC 46 >XP_016475421.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180 [Nicotiana tabacum] Length = 426 Score = 53.5 bits (127), Expect = 2e-06 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = -3 Query: 111 IFISVLQVHSITHWQDIQVLEDFKNAVSPNSASPGSC 1 + + +L HS THWQDI+VL+ KN+V PNS +PGSC Sbjct: 21 LHVLLLHAHSTTHWQDIEVLKQLKNSVDPNSMTPGSC 57 >XP_009798456.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180 [Nicotiana sylvestris] Length = 426 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/42 (57%), Positives = 31/42 (73%), Gaps = 5/42 (11%) Frame = -3 Query: 111 IFISVLQV-----HSITHWQDIQVLEDFKNAVSPNSASPGSC 1 +F++VL V HS THWQDI+VL+ KN+V PNS +PGSC Sbjct: 16 LFLTVLHVLFLHAHSTTHWQDIEVLKQLKNSVDPNSMTPGSC 57 >XP_016481630.1 PREDICTED: leucine-rich repeat receptor-like protein kinase PXC2 [Nicotiana tabacum] Length = 426 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = -3 Query: 111 IFISVLQV-----HSITHWQDIQVLEDFKNAVSPNSASPGSC 1 IF++VL HS THWQDI+VL+ KN+V PNS +PGSC Sbjct: 16 IFLTVLHALFLHAHSTTHWQDIEVLKQLKNSVDPNSVTPGSC 57 >XP_009605875.1 PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1 [Nicotiana tomentosiformis] Length = 426 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = -3 Query: 111 IFISVLQV-----HSITHWQDIQVLEDFKNAVSPNSASPGSC 1 IF++VL HS THWQDI+VL+ KN+V PNS +PGSC Sbjct: 16 IFLTVLHALFLHAHSTTHWQDIEVLKQLKNSVDPNSVTPGSC 57