BLASTX nr result
ID: Angelica27_contig00037279
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00037279 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237469.1 PREDICTED: protein PTST, chloroplastic [Daucus ca... 63 4e-10 >XP_017237469.1 PREDICTED: protein PTST, chloroplastic [Daucus carota subsp. sativus] XP_017237470.1 PREDICTED: protein PTST, chloroplastic [Daucus carota subsp. sativus] XP_017237471.1 PREDICTED: protein PTST, chloroplastic [Daucus carota subsp. sativus] XP_017237472.1 PREDICTED: protein PTST, chloroplastic [Daucus carota subsp. sativus] Length = 295 Score = 63.2 bits (152), Expect = 4e-10 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +3 Query: 102 MDCHTVAPAKIIFLSSHCSKKHIPWVLWPLRKLKMGHLNR 221 MDCH V+ KIIFLSS CSKK P VLWP++KL MG+LNR Sbjct: 1 MDCHAVSLGKIIFLSSQCSKKSAPRVLWPMQKLNMGYLNR 40