BLASTX nr result
ID: Angelica27_contig00037250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00037250 (402 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJG03074.1 IDI1 [Gentiana rigescens] AJG03075.1 IDI2 [Gentiana r... 110 3e-27 BAE92733.1 isopentenyl pyrophosphate isomerase [Gentiana lutea] 110 3e-27 XP_006350410.1 PREDICTED: isopentenyl-diphosphate Delta-isomeras... 111 4e-27 XP_015073947.1 PREDICTED: isopentenyl-diphosphate Delta-isomeras... 110 5e-27 XP_019153180.1 PREDICTED: isopentenyl-diphosphate Delta-isomeras... 109 5e-27 XP_012834818.1 PREDICTED: isopentenyl-diphosphate Delta-isomeras... 110 5e-27 KMZ66402.1 Isopentenyl-diphosphate Delta-isomerase 2 [Zostera ma... 110 6e-27 AGJ03660.1 putative isopentenyl pyrophosphate isomerase [Eucommi... 108 9e-27 XP_010260544.1 PREDICTED: isopentenyl-diphosphate Delta-isomeras... 110 9e-27 XP_009384255.1 PREDICTED: isopentenyl-diphosphate Delta-isomeras... 110 9e-27 ACS34993.1 plastid isopentenyl diphosphate isomerase [Solanum ly... 110 9e-27 AAF29973.1 isopentenyl pyrophosphate:dimethyllallyl pyrophosphat... 110 1e-26 KVI07921.1 Isopentenyl-diphosphate delta-isomerase, type 1 [Cyna... 109 1e-26 ACN41037.1 unknown [Picea sitchensis] 108 1e-26 NP_001289822.2 isopentenyl diphosphate isomerase [Solanum lycope... 110 1e-26 ALA48967.1 isopentenyl diphosphate isomerase (chloroplast) [Taxu... 108 1e-26 BAC65421.1 isopentenyl-diphosphate delta-isomerase [Periploca se... 108 2e-26 NP_001313111.1 isopentenyl-diphosphate Delta-isomerase I-like [N... 107 2e-26 BAE92732.1 isopentenyl pyrophosphate isomerase [Gentiana lutea] 107 2e-26 AHN92037.1 isopentenyl diphosphate isomerase [Lycium chinense] 108 3e-26 >AJG03074.1 IDI1 [Gentiana rigescens] AJG03075.1 IDI2 [Gentiana rigescens] Length = 235 Score = 110 bits (274), Expect = 3e-27 Identities = 52/62 (83%), Positives = 54/62 (87%) Frame = +1 Query: 217 MATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVF 396 M T V D M A+Q+RLMFEDECILVD DNVVGHDSKYNCHLMEKIESENLLHRAFSVF Sbjct: 1 MGTVVEDSTMDAVQKRLMFEDECILVDANDNVVGHDSKYNCHLMEKIESENLLHRAFSVF 60 Query: 397 LF 402 LF Sbjct: 61 LF 62 >BAE92733.1 isopentenyl pyrophosphate isomerase [Gentiana lutea] Length = 235 Score = 110 bits (274), Expect = 3e-27 Identities = 52/62 (83%), Positives = 54/62 (87%) Frame = +1 Query: 217 MATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVF 396 M T V D M A+Q+RLMFEDECILVD DNVVGHDSKYNCHLMEKIESENLLHRAFSVF Sbjct: 1 MGTVVEDSTMDAVQKRLMFEDECILVDVNDNVVGHDSKYNCHLMEKIESENLLHRAFSVF 60 Query: 397 LF 402 LF Sbjct: 61 LF 62 >XP_006350410.1 PREDICTED: isopentenyl-diphosphate Delta-isomerase I-like [Solanum tuberosum] Length = 302 Score = 111 bits (277), Expect = 4e-27 Identities = 53/81 (65%), Positives = 62/81 (76%) Frame = +1 Query: 160 PVKKVTANTTLCNPSRRRTMATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNC 339 PV + + + TMA V+D +M A+QRRLMFEDECILVD D+VVGHD+KYNC Sbjct: 49 PVSSLRCRFRCYSAASTTTMADAVSDANMDAVQRRLMFEDECILVDENDHVVGHDTKYNC 108 Query: 340 HLMEKIESENLLHRAFSVFLF 402 HLMEKIE+ENLLHRAFSVFLF Sbjct: 109 HLMEKIEAENLLHRAFSVFLF 129 >XP_015073947.1 PREDICTED: isopentenyl-diphosphate Delta-isomerase I [Solanum pennellii] Length = 294 Score = 110 bits (276), Expect = 5e-27 Identities = 52/81 (64%), Positives = 62/81 (76%) Frame = +1 Query: 160 PVKKVTANTTLCNPSRRRTMATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNC 339 PV + + + TMA ++D +M A+QRRLMFEDECILVD D+VVGHD+KYNC Sbjct: 41 PVSSLRCRFRCYSAASTTTMADAISDANMDAVQRRLMFEDECILVDENDHVVGHDTKYNC 100 Query: 340 HLMEKIESENLLHRAFSVFLF 402 HLMEKIE+ENLLHRAFSVFLF Sbjct: 101 HLMEKIEAENLLHRAFSVFLF 121 >XP_019153180.1 PREDICTED: isopentenyl-diphosphate Delta-isomerase I [Ipomoea nil] Length = 235 Score = 109 bits (272), Expect = 5e-27 Identities = 51/62 (82%), Positives = 54/62 (87%) Frame = +1 Query: 217 MATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVF 396 M AD +M A+QRRLMFEDECILVD DNVVGHD+KYNCHLMEKIESENLLHRAFSVF Sbjct: 1 MVDSAADANMDAVQRRLMFEDECILVDENDNVVGHDTKYNCHLMEKIESENLLHRAFSVF 60 Query: 397 LF 402 LF Sbjct: 61 LF 62 >XP_012834818.1 PREDICTED: isopentenyl-diphosphate Delta-isomerase I [Erythranthe guttata] EYU39709.1 hypothetical protein MIMGU_mgv1a010795mg [Erythranthe guttata] Length = 301 Score = 110 bits (276), Expect = 5e-27 Identities = 63/122 (51%), Positives = 72/122 (59%), Gaps = 11/122 (9%) Frame = +1 Query: 70 GYINMLSSKFTTTSRLLVGAIFPFRFQFCRPVKKVTANTTLCNPSRR-----------RT 216 G+ N L++ + S A FP + F +P T+ + R T Sbjct: 8 GFQNWLAAAANSASAFSSSA-FPLKPLFLKPRSIFTSTPAALRRTLRLSSYSTSTAPPST 66 Query: 217 MATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVF 396 M AD M A+QRRLMFEDECILVD D VVGHDSKYNCHLMEKIESENLLHRAFSVF Sbjct: 67 MGDAAADSAMDAVQRRLMFEDECILVDENDRVVGHDSKYNCHLMEKIESENLLHRAFSVF 126 Query: 397 LF 402 LF Sbjct: 127 LF 128 >KMZ66402.1 Isopentenyl-diphosphate Delta-isomerase 2 [Zostera marina] Length = 289 Score = 110 bits (275), Expect = 6e-27 Identities = 65/113 (57%), Positives = 70/113 (61%) Frame = +1 Query: 64 RTGYINMLSSKFTTTSRLLVGAIFPFRFQFCRPVKKVTANTTLCNPSRRRTMATGVADED 243 RT ++ S F+T V FPFRF F R LC+ S M D Sbjct: 23 RTANLSGGSPSFST-----VNVRFPFRFPFRR----------LCSSS----MVNAGVDSG 63 Query: 244 MSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVFLF 402 M IQRRLMFEDECILVD D +VGHDSKYNCHLMEKIESENLLHRAFSVFLF Sbjct: 64 MDDIQRRLMFEDECILVDELDRIVGHDSKYNCHLMEKIESENLLHRAFSVFLF 116 >AGJ03660.1 putative isopentenyl pyrophosphate isomerase [Eucommia ulmoides] Length = 242 Score = 108 bits (271), Expect = 9e-27 Identities = 51/60 (85%), Positives = 54/60 (90%) Frame = +1 Query: 223 TGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVFLF 402 T VAD M A+QRRLMFEDECILVD D+VVGHD+KYNCHLMEKIESENLLHRAFSVFLF Sbjct: 4 TAVADSGMDAVQRRLMFEDECILVDESDHVVGHDTKYNCHLMEKIESENLLHRAFSVFLF 63 >XP_010260544.1 PREDICTED: isopentenyl-diphosphate Delta-isomerase I [Nelumbo nucifera] Length = 329 Score = 110 bits (276), Expect = 9e-27 Identities = 58/100 (58%), Positives = 67/100 (67%), Gaps = 1/100 (1%) Frame = +1 Query: 106 TSRLLVGAIFPFRFQFCRPVKKVTANTTLC-NPSRRRTMATGVADEDMSAIQRRLMFEDE 282 T+ A R +F P+ ++++L + S M D M A+QRRLMFEDE Sbjct: 57 TATTTPAAAVDHRRRFPTPLASSASSSSLATSTSSPAPMGNNAPDSGMDAVQRRLMFEDE 116 Query: 283 CILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVFLF 402 CILVD DNVVGHDSKYNCHLMEKIESENLLHRAFSVFLF Sbjct: 117 CILVDENDNVVGHDSKYNCHLMEKIESENLLHRAFSVFLF 156 >XP_009384255.1 PREDICTED: isopentenyl-diphosphate Delta-isomerase I-like [Musa acuminata subsp. malaccensis] Length = 311 Score = 110 bits (275), Expect = 9e-27 Identities = 63/105 (60%), Positives = 69/105 (65%), Gaps = 24/105 (22%) Frame = +1 Query: 157 RPVKKVTANTTLCNP-------SRR---RTMATG--------------VADEDMSAIQRR 264 RP V A TT P SRR RT+++ VAD DM+A+QRR Sbjct: 33 RPFGSVAAPTTTVTPPLFLPLLSRRSLARTLSSSRTDEAVSMPTDGGAVADADMNAVQRR 92 Query: 265 LMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVFL 399 LMFEDECILVD DNV+GHDSKYNCHLMEKIESENLLHRAFSVFL Sbjct: 93 LMFEDECILVDEHDNVIGHDSKYNCHLMEKIESENLLHRAFSVFL 137 >ACS34993.1 plastid isopentenyl diphosphate isomerase [Solanum lycopersicum] Length = 294 Score = 110 bits (274), Expect = 9e-27 Identities = 51/81 (62%), Positives = 62/81 (76%) Frame = +1 Query: 160 PVKKVTANTTLCNPSRRRTMATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNC 339 PV + + + TMA ++D +M A+QRRLMFEDECILVD D+VVGHD+KYNC Sbjct: 41 PVSSLRCRFRCYSAASTTTMADAISDANMDAVQRRLMFEDECILVDENDHVVGHDTKYNC 100 Query: 340 HLMEKIESENLLHRAFSVFLF 402 HLMEKIE+ENLLHRAFSVF+F Sbjct: 101 HLMEKIEAENLLHRAFSVFIF 121 >AAF29973.1 isopentenyl pyrophosphate:dimethyllallyl pyrophosphate isomerase [Adonis aestivalis var. palaestina] Length = 295 Score = 110 bits (274), Expect = 1e-26 Identities = 61/117 (52%), Positives = 77/117 (65%), Gaps = 8/117 (6%) Frame = +1 Query: 76 INMLSSKFTTTSRLLVGAIFPFRFQFCRPVKKVTANTTLCNPSRR-------RTMATG-V 231 IN L S F+TT++ L + + + ++ ++++ N RR T G V Sbjct: 6 INPLYSIFSTTTKTLSASCSSPAVHLQQRCRTLSISSSITNSPRRGLNRLFASTSTMGEV 65 Query: 232 ADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVFLF 402 AD M A+Q+RLMF+DECILVD D VVGHDSKYNCHLMEKIE+ENLLHRAFSVFLF Sbjct: 66 ADAGMDAVQKRLMFDDECILVDENDKVVGHDSKYNCHLMEKIEAENLLHRAFSVFLF 122 >KVI07921.1 Isopentenyl-diphosphate delta-isomerase, type 1 [Cynara cardunculus var. scolymus] Length = 266 Score = 109 bits (272), Expect = 1e-26 Identities = 52/81 (64%), Positives = 63/81 (77%) Frame = +1 Query: 160 PVKKVTANTTLCNPSRRRTMATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNC 339 P +++++ + SRR ++A D M A+QRRLMF+DECILVD DNVVGHD+KYNC Sbjct: 30 PFLRISSSFSSITISRRSSIAAMGDDSGMDAVQRRLMFDDECILVDENDNVVGHDTKYNC 89 Query: 340 HLMEKIESENLLHRAFSVFLF 402 HLMEKIE ENLLHRAFSVFLF Sbjct: 90 HLMEKIEKENLLHRAFSVFLF 110 >ACN41037.1 unknown [Picea sitchensis] Length = 235 Score = 108 bits (270), Expect = 1e-26 Identities = 51/62 (82%), Positives = 54/62 (87%) Frame = +1 Query: 217 MATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVF 396 M V D M A+QRRLMFEDECILVD ED+V+GHDSKYNCHLMEKIESENLLHRAFSVF Sbjct: 1 MGATVEDTTMDAVQRRLMFEDECILVDEEDHVIGHDSKYNCHLMEKIESENLLHRAFSVF 60 Query: 397 LF 402 LF Sbjct: 61 LF 62 >NP_001289822.2 isopentenyl diphosphate isomerase [Solanum lycopersicum] Length = 303 Score = 110 bits (274), Expect = 1e-26 Identities = 51/81 (62%), Positives = 62/81 (76%) Frame = +1 Query: 160 PVKKVTANTTLCNPSRRRTMATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNC 339 PV + + + TMA ++D +M A+QRRLMFEDECILVD D+VVGHD+KYNC Sbjct: 50 PVSSLRCRFRCYSAASTTTMADAISDANMDAVQRRLMFEDECILVDENDHVVGHDTKYNC 109 Query: 340 HLMEKIESENLLHRAFSVFLF 402 HLMEKIE+ENLLHRAFSVF+F Sbjct: 110 HLMEKIEAENLLHRAFSVFIF 130 >ALA48967.1 isopentenyl diphosphate isomerase (chloroplast) [Taxus x media] Length = 233 Score = 108 bits (269), Expect = 1e-26 Identities = 49/57 (85%), Positives = 55/57 (96%) Frame = +1 Query: 232 ADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVFLF 402 A+E+M A+QRRLMF+DECILVD ED+V+GHDSKYNCHLMEKIESENLLHRAFSVFLF Sbjct: 5 AEENMDAVQRRLMFDDECILVDKEDHVIGHDSKYNCHLMEKIESENLLHRAFSVFLF 61 >BAC65421.1 isopentenyl-diphosphate delta-isomerase [Periploca sepium] Length = 235 Score = 108 bits (269), Expect = 2e-26 Identities = 51/62 (82%), Positives = 54/62 (87%) Frame = +1 Query: 217 MATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVF 396 M VAD M A+QRRLMFEDECILVD D+VVGHD+KYNCHLMEKIESENLLHRAFSVF Sbjct: 1 MGDAVADSAMDAVQRRLMFEDECILVDENDHVVGHDTKYNCHLMEKIESENLLHRAFSVF 60 Query: 397 LF 402 LF Sbjct: 61 LF 62 >NP_001313111.1 isopentenyl-diphosphate Delta-isomerase I-like [Nicotiana tabacum] XP_016509985.1 PREDICTED: isopentenyl-diphosphate Delta-isomerase I-like [Nicotiana tabacum] CAA70850.1 isopentenyl pyrophosphate isomerase [Nicotiana tabacum] Length = 219 Score = 107 bits (267), Expect = 2e-26 Identities = 52/70 (74%), Positives = 57/70 (81%) Frame = +1 Query: 193 CNPSRRRTMATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENL 372 C S R M +AD +M A+QRRLMFEDECILVD D VVGHD+KYNCHLMEKIE+ENL Sbjct: 49 CYSSSTR-MGDAIADANMDAVQRRLMFEDECILVDENDRVVGHDTKYNCHLMEKIEAENL 107 Query: 373 LHRAFSVFLF 402 LHRAFSVFLF Sbjct: 108 LHRAFSVFLF 117 >BAE92732.1 isopentenyl pyrophosphate isomerase [Gentiana lutea] Length = 235 Score = 107 bits (268), Expect = 2e-26 Identities = 51/62 (82%), Positives = 53/62 (85%) Frame = +1 Query: 217 MATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFSVF 396 M T V D M A+Q+RLMFEDECILVD D VVGHDSKYNCHLMEKIESENLLHRAFSVF Sbjct: 1 MGTVVEDSTMDAVQKRLMFEDECILVDANDTVVGHDSKYNCHLMEKIESENLLHRAFSVF 60 Query: 397 LF 402 LF Sbjct: 61 LF 62 >AHN92037.1 isopentenyl diphosphate isomerase [Lycium chinense] Length = 293 Score = 108 bits (271), Expect = 3e-26 Identities = 50/64 (78%), Positives = 56/64 (87%) Frame = +1 Query: 211 RTMATGVADEDMSAIQRRLMFEDECILVDTEDNVVGHDSKYNCHLMEKIESENLLHRAFS 390 R M +ADE+M A+QRRLMF+DECILVD D VVGHD+KYNCHLMEKIE+ENLLHRAFS Sbjct: 57 RRMGDPIADENMDAVQRRLMFDDECILVDENDRVVGHDTKYNCHLMEKIEAENLLHRAFS 116 Query: 391 VFLF 402 VFLF Sbjct: 117 VFLF 120