BLASTX nr result
ID: Angelica27_contig00037083
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00037083 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244594.1 PREDICTED: disease resistance protein RPP13-like ... 54 4e-06 XP_017241238.1 PREDICTED: putative disease resistance RPP13-like... 53 8e-06 >XP_017244594.1 PREDICTED: disease resistance protein RPP13-like [Daucus carota subsp. sativus] Length = 879 Score = 53.5 bits (127), Expect = 4e-06 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = -1 Query: 304 LQFLKVICFGNLRELQVDDGALPSLKAFQILQCPLIKMDRIPQRVKSLP 158 LQFLKV NL E QVDDGA+PSLK FQI C +KM IP R+ +P Sbjct: 813 LQFLKVKDLPNLEEWQVDDGAMPSLKGFQIEACEKLKM--IPSRITCVP 859 >XP_017241238.1 PREDICTED: putative disease resistance RPP13-like protein 3 isoform X3 [Daucus carota subsp. sativus] Length = 874 Score = 52.8 bits (125), Expect = 8e-06 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 8/58 (13%) Frame = -1 Query: 307 CLQFLKVI-CFGNLRELQVDDGALPSLKAFQILQCPLIK-------MDRIPQRVKSLP 158 CLQFL++ G L ELQVDDGALPSL+AF + + P ++ D IP+R+KSLP Sbjct: 807 CLQFLRIQPATGALFELQVDDGALPSLRAFTLERLPFLRAFLLNADRDMIPRRLKSLP 864