BLASTX nr result
ID: Angelica27_contig00036853
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036853 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM30946.1 hypothetical protein LR48_Vigan01g050100 [Vigna angul... 65 2e-10 KHN47975.1 hypothetical protein glysoja_015445 [Glycine soja] 65 2e-10 AFG46261.1 hypothetical protein 0_5583_01, partial [Pinus taeda]... 63 2e-10 AEW07575.1 hypothetical protein 0_5583_01, partial [Pinus radiata] 63 2e-10 AEW07574.1 hypothetical protein 0_5583_01, partial [Pinus lamber... 63 2e-10 XP_003629720.1 calcium ion-binding protein [Medicago truncatula]... 66 2e-10 AFK42641.1 unknown [Medicago truncatula] 66 2e-10 XP_017439263.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 65 2e-10 KNA22699.1 hypothetical protein SOVF_032160 [Spinacia oleracea] 65 2e-10 XP_007159415.1 hypothetical protein PHAVU_002G236500g [Phaseolus... 65 2e-10 XP_003524196.1 PREDICTED: uncharacterized protein LOC100802779 [... 65 2e-10 BAT73644.1 hypothetical protein VIGAN_01115300 [Vigna angularis ... 65 2e-10 XP_003531242.1 PREDICTED: uncharacterized protein LOC100801063 [... 65 2e-10 XP_014510619.1 PREDICTED: uncharacterized protein LOC106769493 [... 65 2e-10 KYP67658.1 hypothetical protein KK1_024006 [Cajanus cajan] 65 2e-10 GAU41637.1 hypothetical protein TSUD_81220 [Trifolium subterraneum] 65 2e-10 XP_004504323.1 PREDICTED: uncharacterized protein LOC101506442 [... 65 2e-10 XP_019431741.1 PREDICTED: uncharacterized protein LOC109338850 [... 65 3e-10 NP_192621.1 calcium ion binding protein [Arabidopsis thaliana] C... 65 4e-10 XP_010436308.1 PREDICTED: uncharacterized protein LOC104720030 [... 65 4e-10 >KOM30946.1 hypothetical protein LR48_Vigan01g050100 [Vigna angularis] Length = 292 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 263 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 292 >KHN47975.1 hypothetical protein glysoja_015445 [Glycine soja] Length = 292 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 263 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 292 >AFG46261.1 hypothetical protein 0_5583_01, partial [Pinus taeda] AFG46262.1 hypothetical protein 0_5583_01, partial [Pinus taeda] AFG46263.1 hypothetical protein 0_5583_01, partial [Pinus taeda] AFG46264.1 hypothetical protein 0_5583_01, partial [Pinus taeda] AFG46265.1 hypothetical protein 0_5583_01, partial [Pinus taeda] AFG46266.1 hypothetical protein 0_5583_01, partial [Pinus taeda] AFG46267.1 hypothetical protein 0_5583_01, partial [Pinus taeda] AFG46268.1 hypothetical protein 0_5583_01, partial [Pinus taeda] AFG46269.1 hypothetical protein 0_5583_01, partial [Pinus taeda] AFG46270.1 hypothetical protein 0_5583_01, partial [Pinus taeda] Length = 143 Score = 63.2 bits (152), Expect = 2e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2 EVDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 EVDTEVF RGKTRVETF NLT+DCKDGINTC Sbjct: 113 EVDTEVFLRGKTRVETFNNLTKDCKDGINTC 143 >AEW07575.1 hypothetical protein 0_5583_01, partial [Pinus radiata] Length = 143 Score = 63.2 bits (152), Expect = 2e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2 EVDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 EVDTEVF RGKTRVETF NLT+DCKDGINTC Sbjct: 113 EVDTEVFLRGKTRVETFNNLTKDCKDGINTC 143 >AEW07574.1 hypothetical protein 0_5583_01, partial [Pinus lambertiana] AFB32885.1 hypothetical protein 0_5583_01, partial [Pinus cembra] Length = 143 Score = 63.2 bits (152), Expect = 2e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2 EVDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 EVDTEVFFR KTRVETF NLT+DCKDGINTC Sbjct: 113 EVDTEVFFRAKTRVETFNNLTKDCKDGINTC 143 >XP_003629720.1 calcium ion-binding protein [Medicago truncatula] AET04196.1 calcium ion-binding protein [Medicago truncatula] Length = 573 Score = 65.9 bits (159), Expect = 2e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDGINTC Sbjct: 544 VDTEVFYRGKTRVETFYNLTKDCKDGINTC 573 >AFK42641.1 unknown [Medicago truncatula] Length = 573 Score = 65.9 bits (159), Expect = 2e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDGINTC Sbjct: 544 VDTEVFYRGKTRVETFYNLTKDCKDGINTC 573 >XP_017439263.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC108345191 [Vigna angularis] Length = 537 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 508 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 537 >KNA22699.1 hypothetical protein SOVF_032160 [Spinacia oleracea] Length = 556 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 EVDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 EVDTEVF RGKTRVETFYNLT DCKDGINTC Sbjct: 526 EVDTEVFIRGKTRVETFYNLTSDCKDGINTC 556 >XP_007159415.1 hypothetical protein PHAVU_002G236500g [Phaseolus vulgaris] ESW31409.1 hypothetical protein PHAVU_002G236500g [Phaseolus vulgaris] Length = 573 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 544 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 573 >XP_003524196.1 PREDICTED: uncharacterized protein LOC100802779 [Glycine max] KRH58921.1 hypothetical protein GLYMA_05G156200 [Glycine max] Length = 573 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 544 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 573 >BAT73644.1 hypothetical protein VIGAN_01115300 [Vigna angularis var. angularis] Length = 574 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 545 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 574 >XP_003531242.1 PREDICTED: uncharacterized protein LOC100801063 [Glycine max] KRH42826.1 hypothetical protein GLYMA_08G114200 [Glycine max] Length = 575 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 546 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 575 >XP_014510619.1 PREDICTED: uncharacterized protein LOC106769493 [Vigna radiata var. radiata] Length = 576 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 547 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 576 >KYP67658.1 hypothetical protein KK1_024006 [Cajanus cajan] Length = 578 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 549 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 578 >GAU41637.1 hypothetical protein TSUD_81220 [Trifolium subterraneum] Length = 582 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 553 VDTEVFYRGKTRVETFYNLTKDCKDGVNTC 582 >XP_004504323.1 PREDICTED: uncharacterized protein LOC101506442 [Cicer arietinum] Length = 585 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 2 EVDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 EVDTEVF+RGK RVETFYNLT+DCKDG+NTC Sbjct: 555 EVDTEVFYRGKNRVETFYNLTKDCKDGVNTC 585 >XP_019431741.1 PREDICTED: uncharacterized protein LOC109338850 [Lupinus angustifolius] OIW20789.1 hypothetical protein TanjilG_23169 [Lupinus angustifolius] Length = 576 Score = 65.1 bits (157), Expect = 3e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT+DCKDG+NTC Sbjct: 547 VDTEVFYRGKTRVETFYNLTQDCKDGVNTC 576 >NP_192621.1 calcium ion binding protein [Arabidopsis thaliana] CAB78006.1 putative protein [Arabidopsis thaliana] CAB82117.1 putative protein [Arabidopsis thaliana] AAL08248.1 AT4g08810/T32A17_120 [Arabidopsis thaliana] AAO11571.1 At4g08810/T32A17_120 [Arabidopsis thaliana] AEE82680.1 calcium ion binding protein [Arabidopsis thaliana] OAO97252.1 SUB1 [Arabidopsis thaliana] Length = 552 Score = 64.7 bits (156), Expect = 4e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT DCKDGINTC Sbjct: 523 VDTEVFYRGKTRVETFYNLTTDCKDGINTC 552 >XP_010436308.1 PREDICTED: uncharacterized protein LOC104720030 [Camelina sativa] Length = 554 Score = 64.7 bits (156), Expect = 4e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 5 VDTEVFFRGKTRVETFYNLTRDCKDGINTC 94 VDTEVF+RGKTRVETFYNLT DCKDGINTC Sbjct: 525 VDTEVFYRGKTRVETFYNLTTDCKDGINTC 554