BLASTX nr result
ID: Angelica27_contig00036827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036827 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006404661.1 hypothetical protein EUTSA_v10000197mg [Eutrema s... 86 2e-17 OAP08817.1 hypothetical protein AXX17_AT2G17660 [Arabidopsis tha... 85 4e-17 NP_565526.1 RNA-binding (RRM/RBD/RNP motifs) family protein [Ara... 85 4e-17 AAM65774.1 putative RNA-binding protein [Arabidopsis thaliana] 85 4e-17 JAU66063.1 UBP1-associated proteins 1B [Noccaea caerulescens] 84 6e-17 XP_006295754.1 hypothetical protein CARUB_v10024874mg [Capsella ... 84 7e-17 XP_013631914.1 PREDICTED: UBP1-associated proteins 1B [Brassica ... 84 7e-17 JAU99225.1 UBP1-associated proteins 1B, partial [Noccaea caerule... 84 8e-17 JAU07246.1 UBP1-associated proteins 1B, partial [Noccaea caerule... 84 8e-17 XP_002880417.1 hypothetical protein ARALYDRAFT_481073 [Arabidops... 84 1e-16 AFG51193.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] 79 1e-16 XP_018831010.1 PREDICTED: UBP1-associated protein 2B-like [Jugla... 84 2e-16 XP_009140321.1 PREDICTED: UBP1-associated proteins 1B [Brassica ... 83 2e-16 XP_013716895.1 PREDICTED: UBP1-associated proteins 1B-like [Bras... 83 2e-16 CDY15850.1 BnaA04g12610D [Brassica napus] 83 2e-16 XP_018815234.1 PREDICTED: UBP1-associated protein 2B-like [Jugla... 83 3e-16 AEW09371.1 hypothetical protein UMN_7377_01, partial [Pinus radi... 77 6e-16 ABK24718.1 unknown [Picea sitchensis] ABR18466.1 unknown [Picea ... 81 1e-15 XP_012072578.1 PREDICTED: UBP1-associated protein 2B-like [Jatro... 81 1e-15 ABR18205.1 unknown [Picea sitchensis] 80 1e-15 >XP_006404661.1 hypothetical protein EUTSA_v10000197mg [Eutrema salsugineum] ESQ46114.1 hypothetical protein EUTSA_v10000197mg [Eutrema salsugineum] Length = 384 Score = 85.5 bits (210), Expect = 2e-17 Identities = 39/76 (51%), Positives = 55/76 (72%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 F F+KED+ NLLE +SKEEL++++ K +K + L+S V ES +D ++R +FVRGL W+T Sbjct: 120 FEFDKEDIKNLLESYSKEELVNLIYKTAEKGSRLISTVLESADRDTAQRNIFVRGLGWDT 179 Query: 284 TSETLRERFGQYGEIE 331 T E L+ F YGEIE Sbjct: 180 THENLKTAFEVYGEIE 195 >OAP08817.1 hypothetical protein AXX17_AT2G17660 [Arabidopsis thaliana] Length = 382 Score = 84.7 bits (208), Expect = 4e-17 Identities = 39/75 (52%), Positives = 54/75 (72%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 F F+KED+ NLLE +SKEEL++++ K +K + L+S V ES +D S+R +FVRGL W+T Sbjct: 115 FEFDKEDIKNLLESYSKEELINLIYKTAEKGSKLISAVFESADRDSSQRNIFVRGLGWDT 174 Query: 284 TSETLRERFGQYGEI 328 T E L+ F YGEI Sbjct: 175 THENLKAAFEVYGEI 189 >NP_565526.1 RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis thaliana] Q9SHZ5.2 RecName: Full=UBP1-associated proteins 1B AAD25814.2 putative RNA-binding protein [Arabidopsis thaliana] AEC07264.1 RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis thaliana] Length = 382 Score = 84.7 bits (208), Expect = 4e-17 Identities = 39/75 (52%), Positives = 54/75 (72%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 F F+KED+ NLLE +SKEEL++++ K +K + L+S V ES +D S+R +FVRGL W+T Sbjct: 115 FEFDKEDIKNLLESYSKEELINLIYKTAEKGSKLISAVFESADRDSSQRNIFVRGLGWDT 174 Query: 284 TSETLRERFGQYGEI 328 T E L+ F YGEI Sbjct: 175 THENLKAAFEVYGEI 189 >AAM65774.1 putative RNA-binding protein [Arabidopsis thaliana] Length = 382 Score = 84.7 bits (208), Expect = 4e-17 Identities = 39/75 (52%), Positives = 54/75 (72%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 F F+KED+ NLLE +SKEEL++++ K +K + L+S V ES +D S+R +FVRGL W+T Sbjct: 115 FEFDKEDIKNLLESYSKEELINLIYKTAEKGSKLISAVFESADRDSSQRNIFVRGLGWDT 174 Query: 284 TSETLRERFGQYGEI 328 T E L+ F YGEI Sbjct: 175 THENLKAAFEVYGEI 189 >JAU66063.1 UBP1-associated proteins 1B [Noccaea caerulescens] Length = 386 Score = 84.3 bits (207), Expect = 6e-17 Identities = 39/76 (51%), Positives = 56/76 (73%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 F FEKED+ +LLE +SKEEL++++ K +K + L+S V ES +D ++R VFVRGL W+T Sbjct: 126 FEFEKEDIKHLLESYSKEELINLIYKTAEKGSRLISAVLESADRDSAQRNVFVRGLGWDT 185 Query: 284 TSETLRERFGQYGEIE 331 T E+L+ F YGEI+ Sbjct: 186 THESLKAAFEVYGEID 201 >XP_006295754.1 hypothetical protein CARUB_v10024874mg [Capsella rubella] EOA28652.1 hypothetical protein CARUB_v10024874mg [Capsella rubella] Length = 410 Score = 84.3 bits (207), Expect = 7e-17 Identities = 39/76 (51%), Positives = 54/76 (71%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 F F+KED+ NLLE +SKEEL++++ K +K + L+S V ES +D S+R +FVRGL W+T Sbjct: 120 FEFDKEDIKNLLESYSKEELINLIYKTAEKGSKLISAVLESADRDTSQRNIFVRGLGWDT 179 Query: 284 TSETLRERFGQYGEIE 331 T E L+ YGEIE Sbjct: 180 THENLKAALEVYGEIE 195 >XP_013631914.1 PREDICTED: UBP1-associated proteins 1B [Brassica oleracea var. oleracea] XP_013671391.1 PREDICTED: UBP1-associated proteins 1B-like [Brassica napus] Length = 370 Score = 84.0 bits (206), Expect = 7e-17 Identities = 40/74 (54%), Positives = 54/74 (72%) Frame = +2 Query: 110 FEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWETTS 289 F+KED+ +LLE ++KEEL+S++ K +K + L+S V ES D SKR +FVRGL W+TT Sbjct: 123 FDKEDLKHLLETYTKEELVSLIHKTAEKGSRLISAVLESAELDSSKRNIFVRGLGWDTTH 182 Query: 290 ETLRERFGQYGEIE 331 ETL+ F YGEIE Sbjct: 183 ETLKAAFEVYGEIE 196 >JAU99225.1 UBP1-associated proteins 1B, partial [Noccaea caerulescens] Length = 387 Score = 84.0 bits (206), Expect = 8e-17 Identities = 38/76 (50%), Positives = 56/76 (73%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 F FEKED+ +LLE +SKEEL++++ K +K + L+S V ES +D ++R +FVRGL W+T Sbjct: 127 FEFEKEDIKHLLESYSKEELINLIYKTAEKGSRLISAVLESADRDSAQRNIFVRGLGWDT 186 Query: 284 TSETLRERFGQYGEIE 331 T E+L+ F YGEI+ Sbjct: 187 THESLKAAFEVYGEID 202 >JAU07246.1 UBP1-associated proteins 1B, partial [Noccaea caerulescens] Length = 389 Score = 84.0 bits (206), Expect = 8e-17 Identities = 38/76 (50%), Positives = 56/76 (73%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 F FEKED+ +LLE +SKEEL++++ K +K + L+S V ES +D ++R +FVRGL W+T Sbjct: 129 FEFEKEDIKHLLESYSKEELINLIYKTAEKGSRLISAVLESADRDSAQRNIFVRGLGWDT 188 Query: 284 TSETLRERFGQYGEIE 331 T E+L+ F YGEI+ Sbjct: 189 THESLKAAFEVYGEID 204 >XP_002880417.1 hypothetical protein ARALYDRAFT_481073 [Arabidopsis lyrata subsp. lyrata] EFH56676.1 hypothetical protein ARALYDRAFT_481073, partial [Arabidopsis lyrata subsp. lyrata] Length = 374 Score = 83.6 bits (205), Expect = 1e-16 Identities = 39/76 (51%), Positives = 55/76 (72%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 F F+KEDV +LLE +SKEEL++++ K +K + L+S V ES +D S+R +FVRGL W+T Sbjct: 113 FEFDKEDVKHLLESYSKEELINLIYKTAEKGSKLISAVFESADRDSSQRNIFVRGLGWDT 172 Query: 284 TSETLRERFGQYGEIE 331 T E L+ F +GEIE Sbjct: 173 THENLKAAFEVFGEIE 188 >AFG51193.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] Length = 137 Score = 79.3 bits (194), Expect = 1e-16 Identities = 36/73 (49%), Positives = 52/73 (71%) Frame = +2 Query: 113 EKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWETTSE 292 ++ED+ LL FSKE+L+ I+ + KD L+ ++ + KDP+ RK+FVRGL W+TTSE Sbjct: 39 DEEDLKKLLGPFSKEQLIDIISENAKKDPQLVENIRKLADKDPAHRKIFVRGLGWDTTSE 98 Query: 293 TLRERFGQYGEIE 331 TL+ F QYGE+E Sbjct: 99 TLKSVFSQYGELE 111 >XP_018831010.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018831011.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018831012.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018831013.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] Length = 494 Score = 83.6 bits (205), Expect = 2e-16 Identities = 40/73 (54%), Positives = 53/73 (72%) Frame = +2 Query: 113 EKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWETTSE 292 ++E V+NLLE FSKE+LL++VKKA +K L+ V E DP+ RK+FV GL W+TT+E Sbjct: 133 DEEPVENLLEPFSKEQLLTLVKKAVNKHPDLIESVRELADADPAHRKIFVHGLGWDTTAE 192 Query: 293 TLRERFGQYGEIE 331 L FG+YGEIE Sbjct: 193 NLISVFGRYGEIE 205 >XP_009140321.1 PREDICTED: UBP1-associated proteins 1B [Brassica rapa] Length = 366 Score = 82.8 bits (203), Expect = 2e-16 Identities = 39/74 (52%), Positives = 54/74 (72%) Frame = +2 Query: 110 FEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWETTS 289 F+KED+ +LLE ++KEEL++++ K +K + L+S V ES D SKR +FVRGL W+TT Sbjct: 117 FDKEDLKHLLETYTKEELVNLIHKTAEKGSRLISAVLESAELDSSKRNIFVRGLGWDTTH 176 Query: 290 ETLRERFGQYGEIE 331 ETL+ F YGEIE Sbjct: 177 ETLKAAFEVYGEIE 190 >XP_013716895.1 PREDICTED: UBP1-associated proteins 1B-like [Brassica napus] Length = 370 Score = 82.8 bits (203), Expect = 2e-16 Identities = 39/74 (52%), Positives = 54/74 (72%) Frame = +2 Query: 110 FEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWETTS 289 F+KED+ +LLE ++KEEL++++ K +K + L+S V ES D SKR +FVRGL W+TT Sbjct: 121 FDKEDLKHLLETYTKEELVNLIHKTAEKGSRLISAVLESAELDSSKRNIFVRGLGWDTTH 180 Query: 290 ETLRERFGQYGEIE 331 ETL+ F YGEIE Sbjct: 181 ETLKAAFEVYGEIE 194 >CDY15850.1 BnaA04g12610D [Brassica napus] Length = 370 Score = 82.8 bits (203), Expect = 2e-16 Identities = 39/74 (52%), Positives = 54/74 (72%) Frame = +2 Query: 110 FEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWETTS 289 F+KED+ +LLE ++KEEL++++ K +K + L+S V ES D SKR +FVRGL W+TT Sbjct: 121 FDKEDLKHLLETYTKEELVNLIHKTAEKGSRLISAVLESAELDSSKRNIFVRGLGWDTTH 180 Query: 290 ETLRERFGQYGEIE 331 ETL+ F YGEIE Sbjct: 181 ETLKAAFEVYGEIE 194 >XP_018815234.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018815235.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018815236.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] Length = 483 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/73 (52%), Positives = 52/73 (71%) Frame = +2 Query: 113 EKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWETTSE 292 ++E V+NLL+ FSK++LL+++KKA DK L+ V E DP+ RK+FV GL W+TT+E Sbjct: 123 DEEPVENLLDTFSKDQLLTLIKKAVDKHPDLIEGVRELADADPAHRKIFVHGLGWDTTAE 182 Query: 293 TLRERFGQYGEIE 331 L FG YGEIE Sbjct: 183 NLISVFGSYGEIE 195 >AEW09371.1 hypothetical protein UMN_7377_01, partial [Pinus radiata] AFG51194.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51195.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51196.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51197.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51198.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51199.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51200.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51201.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51202.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51203.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51204.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51205.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51206.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51207.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51208.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51209.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] AFG51210.1 hypothetical protein UMN_7377_01, partial [Pinus taeda] Length = 137 Score = 77.4 bits (189), Expect = 6e-16 Identities = 35/73 (47%), Positives = 51/73 (69%) Frame = +2 Query: 113 EKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWETTSE 292 ++ED+ LL FSKE+L+ I+ + KD L+ ++ + KDP+ RK+FVRGL W+TTSE Sbjct: 39 DEEDLKKLLGPFSKEQLIDIISENAKKDPQLVENIRKLADKDPAHRKIFVRGLGWDTTSE 98 Query: 293 TLRERFGQYGEIE 331 L+ F QYGE+E Sbjct: 99 ALKSVFSQYGELE 111 >ABK24718.1 unknown [Picea sitchensis] ABR18466.1 unknown [Picea sitchensis] Length = 442 Score = 80.9 bits (198), Expect = 1e-15 Identities = 37/73 (50%), Positives = 51/73 (69%) Frame = +2 Query: 113 EKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWETTSE 292 ++ED+ LLE F+KE+L+ I+ + KD LL + + KDP+ RK+FVRGL WETTSE Sbjct: 46 DEEDMKKLLEPFNKEQLMDIISEHAKKDPQLLESIRKLADKDPAHRKIFVRGLGWETTSE 105 Query: 293 TLRERFGQYGEIE 331 L+ F QYGE+E Sbjct: 106 ALKSVFSQYGELE 118 >XP_012072578.1 PREDICTED: UBP1-associated protein 2B-like [Jatropha curcas] KDP37881.1 hypothetical protein JCGZ_05763 [Jatropha curcas] Length = 509 Score = 80.9 bits (198), Expect = 1e-15 Identities = 39/78 (50%), Positives = 55/78 (70%), Gaps = 5/78 (6%) Frame = +2 Query: 113 EKEDVDN-----LLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSW 277 E+EDVD+ LLE F K++L+ +++KA DK + L+ V E DP+ RK+FV GL W Sbjct: 135 EEEDVDDEPLEKLLEPFGKDQLVVLLRKAVDKYSDLMDSVREIADADPAHRKIFVHGLGW 194 Query: 278 ETTSETLRERFGQYGEIE 331 +TT+ETL+ FG+YGEIE Sbjct: 195 DTTAETLKSEFGKYGEIE 212 >ABR18205.1 unknown [Picea sitchensis] Length = 382 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/76 (50%), Positives = 50/76 (65%) Frame = +2 Query: 104 FSFEKEDVDNLLEIFSKEELLSIVKKAFDKDNGLLSDVSESVSKDPSKRKVFVRGLSWET 283 + F KED + L+E FSK+EL I+K A K ++S+V+ SKD +KRK+FVRGL W T Sbjct: 107 YVFTKEDAETLMETFSKDELAEILKLALKKHGDIVSEVANVASKDSAKRKLFVRGLGWHT 166 Query: 284 TSETLRERFGQYGEIE 331 ETL F YGE+E Sbjct: 167 KPETLNSVFSAYGEVE 182