BLASTX nr result
ID: Angelica27_contig00036806
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036806 (453 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ANS72117.1 NdhJ (chloroplast) [Ledebouriella seseloides] 178 7e-55 YP_009155297.1 NADH-plastoquinone oxidoreductase subunit J (plas... 178 7e-55 YP_009155215.1 NADH dehydrogenase subunit J (plastid) [Pastinaca... 178 7e-55 YP_009338511.1 NADH-plastoquinone oxidoreductase subunit J (chlo... 177 2e-54 YP_009235882.1 NADH-plastoquinone oxidoreductase subunit J (chlo... 177 3e-54 YP_009164321.1 NdhJ (chloroplast) [Bupleurum falcatum] AIY72307.... 176 8e-54 YP_009331700.1 NdhJ (chloroplast) [Arracacia xanthorrhiza] APH07... 175 1e-53 AKZ22298.1 NADH dehydrogenase subunit J (plastid) [Zizia aurea] 175 1e-53 YP_740120.1 NADH-plastoquinone oxidoreductase subunit J (chlorop... 175 1e-53 YP_009232832.1 NdhJ (chloroplast) [Angelica dahurica] AMA97895.1... 175 2e-53 ADK89781.1 NADH-plastoquinone oxidoreductase subunit J (chloropl... 175 2e-53 YP_004222649.1 NADH-plastoquinone oxidoreductase subunit J (chlo... 175 2e-53 YP_009338260.1 NADH-plastoquinone oxidoreductase subunit J (chlo... 174 2e-53 YP_009245676.1 NADH-plastoquinone oxidoreductase subunit J (chlo... 174 2e-53 AMK95929.1 NADH-plastoquinone oxidoreductase subunit J (chloropl... 174 3e-53 AFU94827.1 NdhJ, partial (chloroplast) [Clusia rosea] 174 3e-53 ANY60467.1 NADH-plastoquinone oxidoreductase subunit J (chloropl... 173 7e-53 YP_009272251.1 NADH-plastoquinone oxidoreductase subunit J (chlo... 173 7e-53 YP_009245013.1 NADH dehydrogenase subunit J (chloroplast) [Kolkw... 173 7e-53 AII18048.1 NADH-plastioquinone oxidoreductase subunit J protein,... 173 7e-53 >ANS72117.1 NdhJ (chloroplast) [Ledebouriella seseloides] Length = 158 Score = 178 bits (452), Expect = 7e-55 Identities = 81/81 (100%), Positives = 81/81 (100%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYIVPNFYEIQDAH Sbjct: 138 IGWPLRKDYIVPNFYEIQDAH 158 >YP_009155297.1 NADH-plastoquinone oxidoreductase subunit J (plastid) [Seseli montanum] YP_009186256.1 NdhJ (chloroplast) [Ostericum grosseserratum] YP_009232747.1 NdhJ (chloroplast) [Angelica acutiloba] YP_009232917.1 NdhJ (chloroplast) [Angelica gigas] YP_009233002.1 NdhJ (chloroplast) [Ligusticum tenuissimum] YP_009243569.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Coriandrum sativum] AIU99105.1 NADH-plastoquinone oxidoreductase subunit J (plastid) [Seseli montanum] AKS03619.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Coriandrum sativum] ALN96823.1 NAD(P)H-quinone oxidoreductase chain J (chloroplast) [Angelica decursiva] ALO71599.1 NdhJ (chloroplast) [Ostericum grosseserratum] AMA97809.1 NdhJ (chloroplast) [Angelica acutiloba] AMA97980.1 NdhJ (chloroplast) [Angelica gigas] AMA98064.1 NdhJ (chloroplast) [Ligusticum tenuissimum] ANS72033.1 NdhJ (chloroplast) [Glehnia littoralis] Length = 158 Score = 178 bits (452), Expect = 7e-55 Identities = 81/81 (100%), Positives = 81/81 (100%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYIVPNFYEIQDAH Sbjct: 138 IGWPLRKDYIVPNFYEIQDAH 158 >YP_009155215.1 NADH dehydrogenase subunit J (plastid) [Pastinaca pimpinellifolia] AIU99023.1 NADH dehydrogenase subunit J (plastid) [Pastinaca pimpinellifolia] Length = 158 Score = 178 bits (452), Expect = 7e-55 Identities = 81/81 (100%), Positives = 81/81 (100%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYIVPNFYEIQDAH Sbjct: 138 IGWPLRKDYIVPNFYEIQDAH 158 >YP_009338511.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Bupleurum latissimum] ANK36606.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Bupleurum latissimum] Length = 158 Score = 177 bits (449), Expect = 2e-54 Identities = 80/81 (98%), Positives = 81/81 (100%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVF+PRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFAPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYIVPNFYEIQDAH Sbjct: 138 IGWPLRKDYIVPNFYEIQDAH 158 >YP_009235882.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Foeniculum vulgare] YP_009235967.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Anethum graveolens] YP_009338429.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Pterygopleurum neurophyllum] ABU85221.1 NADH-plastoquinone oxidoreductase subunit J, partial (chloroplast) [Anethum graveolens] ADK89866.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Crithmum maritimum] ADK89954.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Petroselinum crispum] AKZ22296.1 NADH dehydrogenase subunit J (plastid) [Cicuta maculata] AKZ22297.1 NADH dehydrogenase subunit J (plastid) [Conium maculatum] AMD83918.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Foeniculum vulgare] AMD84003.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Anethum graveolens] ANK36524.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Pterygopleurum neurophyllum] Length = 158 Score = 177 bits (448), Expect = 3e-54 Identities = 80/81 (98%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >YP_009164321.1 NdhJ (chloroplast) [Bupleurum falcatum] AIY72307.1 NdhJ (chloroplast) [Bupleurum falcatum] Length = 158 Score = 176 bits (445), Expect = 8e-54 Identities = 79/81 (97%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVF+PRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFAPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >YP_009331700.1 NdhJ (chloroplast) [Arracacia xanthorrhiza] APH07268.1 NdhJ (chloroplast) [Arracacia xanthorrhiza] Length = 158 Score = 175 bits (444), Expect = 1e-53 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDA 213 IGWPLRKDYIVPNFYEIQDA Sbjct: 138 IGWPLRKDYIVPNFYEIQDA 157 >AKZ22298.1 NADH dehydrogenase subunit J (plastid) [Zizia aurea] Length = 158 Score = 175 bits (444), Expect = 1e-53 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDA 213 IGWPLRKDYIVPNFYEIQDA Sbjct: 138 IGWPLRKDYIVPNFYEIQDA 157 >YP_740120.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Daucus carota] Q0G9V9.1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chloroplastic; AltName: Full=NAD(P)H dehydrogenase subunit J; AltName: Full=NADH-plastoquinone oxidoreductase subunit J ABI32427.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Daucus carota] KZM81225.1 NADH dehydrogenase subunit J (plastid) [Daucus carota subsp. sativus] Length = 158 Score = 175 bits (444), Expect = 1e-53 Identities = 79/81 (97%), Positives = 79/81 (97%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWK VDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKGVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >YP_009232832.1 NdhJ (chloroplast) [Angelica dahurica] AMA97895.1 NdhJ (chloroplast) [Angelica dahurica] Length = 158 Score = 175 bits (443), Expect = 2e-53 Identities = 80/81 (98%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISY NHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYYNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYIVPNFYEIQDAH Sbjct: 138 IGWPLRKDYIVPNFYEIQDAH 158 >ADK89781.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Tiedemannia filiformis subsp. greenmannii] Length = 158 Score = 175 bits (443), Expect = 2e-53 Identities = 79/81 (97%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI P+FYEIQDAH Sbjct: 138 IGWPLRKDYIAPDFYEIQDAH 158 >YP_004222649.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Anthriscus cerefolium] ADD13641.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Anthriscus cerefolium] Length = 158 Score = 175 bits (443), Expect = 2e-53 Identities = 79/81 (97%), Positives = 79/81 (97%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPR NPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRNNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >YP_009338260.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Pleurospermum camtschaticum] ANK36355.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Pleurospermum camtschaticum] Length = 158 Score = 174 bits (442), Expect = 2e-53 Identities = 78/81 (96%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVF+PRKNPRIPSVFWVWKSVDFQERES+DMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFAPRKNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >YP_009245676.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Carum carvi] AKS28691.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Carum carvi] Length = 158 Score = 174 bits (442), Expect = 2e-53 Identities = 79/81 (97%), Positives = 79/81 (97%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGI YDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGIVYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >AMK95929.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Saltugilia latimeri] AMK95988.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Saltugilia splendens subsp. splendens] Length = 158 Score = 174 bits (441), Expect = 3e-53 Identities = 77/81 (95%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 +DQPEEVCIKVF+PR+NPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW Sbjct: 78 IDQPEEVCIKVFTPRRNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >AFU94827.1 NdhJ, partial (chloroplast) [Clusia rosea] Length = 159 Score = 174 bits (441), Expect = 3e-53 Identities = 78/80 (97%), Positives = 79/80 (98%) Frame = -2 Query: 449 DQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESWI 270 DQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERES+DMLGISYDNHPRLKRILMPESWI Sbjct: 80 DQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWI 139 Query: 269 GWPLRKDYIVPNFYEIQDAH 210 GWPLRKDYI PNFYEIQDAH Sbjct: 140 GWPLRKDYIAPNFYEIQDAH 159 >ANY60467.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Maesa montana] Length = 158 Score = 173 bits (439), Expect = 7e-53 Identities = 77/81 (95%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVF+PR+NPRIPSVFWVWKSVDFQERES+DMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFAPRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >YP_009272251.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros oleifera] YP_009272351.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros kaki] YP_009271993.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros glaucifolia] YP_009272164.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros lotus] YP_009342850.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros blancoi] AJA38274.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros glaucifolia] AJF94044.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros sp. LHM-2015] AJF94132.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros lotus] AJF94219.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros oleifera] AMD07897.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros kaki] APS85594.1 NADH-plastoquinone oxidoreductase subunit J (chloroplast) [Diospyros blancoi] Length = 158 Score = 173 bits (439), Expect = 7e-53 Identities = 77/81 (95%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVF+PR+NPRIPSVFWVWKSVDFQERES+DMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFAPRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >YP_009245013.1 NADH dehydrogenase subunit J (chloroplast) [Kolkwitzia amabilis] AMR73782.1 NADH dehydrogenase subunit J (chloroplast) [Kolkwitzia amabilis] Length = 158 Score = 173 bits (439), Expect = 7e-53 Identities = 77/81 (95%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVF+PR+NPRIPSVFWVWKSVDFQERES+DMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFAPRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158 >AII18048.1 NADH-plastioquinone oxidoreductase subunit J protein, partial (chloroplast) [Viburnum taiwanianum] Length = 158 Score = 173 bits (439), Expect = 7e-53 Identities = 77/81 (95%), Positives = 80/81 (98%) Frame = -2 Query: 452 VDQPEEVCIKVFSPRKNPRIPSVFWVWKSVDFQERESFDMLGISYDNHPRLKRILMPESW 273 VDQPEEVCIKVF+PR+NPRIPSVFWVWKSVDFQERES+DMLGISYDNHPRLKRILMPESW Sbjct: 78 VDQPEEVCIKVFAPRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESW 137 Query: 272 IGWPLRKDYIVPNFYEIQDAH 210 IGWPLRKDYI PNFYEIQDAH Sbjct: 138 IGWPLRKDYIAPNFYEIQDAH 158