BLASTX nr result
ID: Angelica27_contig00036802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036802 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017231406.1 PREDICTED: reticulon-like protein B9 [Daucus caro... 105 9e-26 XP_019460281.1 PREDICTED: reticulon-like protein B14 [Lupinus an... 87 6e-19 XP_016515940.1 PREDICTED: reticulon-like protein B9 [Nicotiana t... 87 1e-18 XP_002282955.1 PREDICTED: reticulon-like protein B9 isoform X2 [... 86 3e-18 XP_019242888.1 PREDICTED: reticulon-like protein B9 [Nicotiana a... 86 4e-18 XP_019077039.1 PREDICTED: reticulon-like protein B9 isoform X1 [... 86 4e-18 XP_011078306.1 PREDICTED: reticulon-like protein B9 [Sesamum ind... 86 4e-18 XP_009778718.1 PREDICTED: reticulon-like protein B9 [Nicotiana s... 85 7e-18 CBI26976.3 unnamed protein product, partial [Vitis vinifera] 86 9e-18 XP_010279360.1 PREDICTED: reticulon-like protein B9 [Nelumbo nuc... 84 2e-17 XP_019229301.1 PREDICTED: reticulon-like protein B9 [Nicotiana a... 83 3e-17 XP_009760503.1 PREDICTED: reticulon-like protein B9 [Nicotiana s... 83 3e-17 XP_016481515.1 PREDICTED: reticulon-like protein B9 [Nicotiana t... 83 4e-17 XP_013470156.1 reticulon-like protein B2 [Medicago truncatula] K... 82 4e-17 XP_011071252.1 PREDICTED: reticulon-like protein B9 [Sesamum ind... 82 7e-17 XP_018858756.1 PREDICTED: reticulon-like protein B14 [Juglans re... 82 8e-17 XP_019451947.1 PREDICTED: reticulon-like protein B9 [Lupinus ang... 82 1e-16 XP_009588252.1 PREDICTED: reticulon-like protein B9 [Nicotiana t... 82 1e-16 KYP75133.1 Reticulon-like protein B9 [Cajanus cajan] 81 1e-16 GAU14779.1 hypothetical protein TSUD_49910 [Trifolium subterraneum] 80 2e-16 >XP_017231406.1 PREDICTED: reticulon-like protein B9 [Daucus carota subsp. sativus] KZN06426.1 hypothetical protein DCAR_007263 [Daucus carota subsp. sativus] Length = 216 Score = 105 bits (261), Expect = 9e-26 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 LETLPFLYEKYE EVDYLAS+GNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR Sbjct: 165 LETLPFLYEKYEREVDYLASKGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 216 >XP_019460281.1 PREDICTED: reticulon-like protein B14 [Lupinus angustifolius] OIW02023.1 hypothetical protein TanjilG_11616 [Lupinus angustifolius] Length = 210 Score = 87.4 bits (215), Expect = 6e-19 Identities = 39/52 (75%), Positives = 48/52 (92%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 L TLP +YE+YE EVDYLAS+GN+D ++L+KKFD++VLNKIPRGPVKEKKFR Sbjct: 159 LITLPLMYERYEYEVDYLASKGNQDLRRLFKKFDSQVLNKIPRGPVKEKKFR 210 >XP_016515940.1 PREDICTED: reticulon-like protein B9 [Nicotiana tabacum] Length = 217 Score = 86.7 bits (213), Expect = 1e-18 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -2 Query: 350 TLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKK 207 TLP +YEKY+ EVDYLAS+GN+D KKLYKKFD KVLNKIPRGPVKE+K Sbjct: 168 TLPAMYEKYQDEVDYLASKGNQDMKKLYKKFDTKVLNKIPRGPVKERK 215 >XP_002282955.1 PREDICTED: reticulon-like protein B9 isoform X2 [Vitis vinifera] Length = 216 Score = 85.5 bits (210), Expect = 3e-18 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 +ETLP LYE+YE +VD +A +GNR+ KKLY+KFD+ VLNKIPRGPVKEKKFR Sbjct: 165 METLPALYERYEEQVDEIADKGNRNVKKLYRKFDSHVLNKIPRGPVKEKKFR 216 >XP_019242888.1 PREDICTED: reticulon-like protein B9 [Nicotiana attenuata] OIT06922.1 reticulon-like protein b9 [Nicotiana attenuata] Length = 220 Score = 85.5 bits (210), Expect = 4e-18 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKK 207 L T P +YEKY+ EVDYLAS+GN+D KK+YKKFD KVLNKIPRGPVKE+K Sbjct: 169 LATFPAMYEKYQDEVDYLASKGNQDMKKMYKKFDTKVLNKIPRGPVKERK 218 >XP_019077039.1 PREDICTED: reticulon-like protein B9 isoform X1 [Vitis vinifera] Length = 221 Score = 85.5 bits (210), Expect = 4e-18 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 +ETLP LYE+YE +VD +A +GNR+ KKLY+KFD+ VLNKIPRGPVKEKKFR Sbjct: 170 METLPALYERYEEQVDEIADKGNRNVKKLYRKFDSHVLNKIPRGPVKEKKFR 221 >XP_011078306.1 PREDICTED: reticulon-like protein B9 [Sesamum indicum] Length = 227 Score = 85.5 bits (210), Expect = 4e-18 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKK 207 L T+P LYE+Y+ +VDYLASRGNRD KKLYKK D+++LNKIPRGPVKEKK Sbjct: 176 LMTIPALYERYQGQVDYLASRGNRDMKKLYKKIDSRILNKIPRGPVKEKK 225 >XP_009778718.1 PREDICTED: reticulon-like protein B9 [Nicotiana sylvestris] XP_016509564.1 PREDICTED: reticulon-like protein B9 [Nicotiana tabacum] Length = 220 Score = 84.7 bits (208), Expect = 7e-18 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKK 207 L ++P +YEKY+ EVDYLAS+GN+D KKLYKKFD KVLNKIPRGPVKE+K Sbjct: 169 LASIPAMYEKYQDEVDYLASKGNQDMKKLYKKFDNKVLNKIPRGPVKERK 218 >CBI26976.3 unnamed protein product, partial [Vitis vinifera] Length = 267 Score = 85.5 bits (210), Expect = 9e-18 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 +ETLP LYE+YE +VD +A +GNR+ KKLY+KFD+ VLNKIPRGPVKEKKFR Sbjct: 216 METLPALYERYEEQVDEIADKGNRNVKKLYRKFDSHVLNKIPRGPVKEKKFR 267 >XP_010279360.1 PREDICTED: reticulon-like protein B9 [Nelumbo nucifera] Length = 224 Score = 83.6 bits (205), Expect = 2e-17 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 ++TLP LYE+YE +VD+LAS+GNRD KKLY+KFD+KVL KIPRGP K+KK + Sbjct: 173 IQTLPALYERYEKDVDHLASKGNRDMKKLYRKFDSKVLKKIPRGPTKDKKLK 224 >XP_019229301.1 PREDICTED: reticulon-like protein B9 [Nicotiana attenuata] OIT30177.1 reticulon-like protein b9 [Nicotiana attenuata] Length = 220 Score = 83.2 bits (204), Expect = 3e-17 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKK 207 L TLP LYE+Y++EVDYL S+GN+D KKLYKKFD +VLNKIPRGPVK++K Sbjct: 169 LATLPALYERYQNEVDYLVSQGNQDMKKLYKKFDTEVLNKIPRGPVKQRK 218 >XP_009760503.1 PREDICTED: reticulon-like protein B9 [Nicotiana sylvestris] Length = 220 Score = 83.2 bits (204), Expect = 3e-17 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKK 207 L TLP LYE+Y++EVDYL S+GN+D KKLYKKFD +VLNKIPRGPVK++K Sbjct: 169 LATLPALYERYQNEVDYLVSQGNQDMKKLYKKFDTEVLNKIPRGPVKQRK 218 >XP_016481515.1 PREDICTED: reticulon-like protein B9 [Nicotiana tabacum] Length = 220 Score = 82.8 bits (203), Expect = 4e-17 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKK 207 L TLP LYE+Y++EVDYL S+GN+D KKLYKKFD +VLNKIPRGPVK++K Sbjct: 169 LATLPALYERYQNEVDYLLSQGNQDMKKLYKKFDTEVLNKIPRGPVKQRK 218 >XP_013470156.1 reticulon-like protein B2 [Medicago truncatula] KEH44194.1 reticulon-like protein B2 [Medicago truncatula] Length = 206 Score = 82.4 bits (202), Expect = 4e-17 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 L TLP +YE+YE EVDYLAS+GN+D K+L+ K D+ VLN+IPRGPVKEKK+R Sbjct: 155 LVTLPIMYERYEHEVDYLASKGNQDVKRLFNKLDSTVLNRIPRGPVKEKKYR 206 >XP_011071252.1 PREDICTED: reticulon-like protein B9 [Sesamum indicum] Length = 216 Score = 82.0 bits (201), Expect = 7e-17 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKK 207 L TLP LYE+Y+ EVDYLA +G+RD KKLYKK D+K LNKIPRGPVKEKK Sbjct: 165 LITLPALYERYQDEVDYLAGKGSRDMKKLYKKLDSKFLNKIPRGPVKEKK 214 >XP_018858756.1 PREDICTED: reticulon-like protein B14 [Juglans regia] Length = 219 Score = 82.0 bits (201), Expect = 8e-17 Identities = 35/51 (68%), Positives = 46/51 (90%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKF 204 ++ LP LY+KYE +VDYLA++G +DAK LY+KFD+KVLNKIPRGPVK++KF Sbjct: 168 MQILPVLYKKYERQVDYLATKGRQDAKSLYRKFDSKVLNKIPRGPVKQRKF 218 >XP_019451947.1 PREDICTED: reticulon-like protein B9 [Lupinus angustifolius] OIW06949.1 hypothetical protein TanjilG_18337 [Lupinus angustifolius] Length = 212 Score = 81.6 bits (200), Expect = 1e-16 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 L TLP +YE+YE EV+YLAS+GN D K+L+ KFD+ VLNKIPRGP+KEKK R Sbjct: 161 LVTLPVMYERYEYEVEYLASKGNNDVKRLFNKFDSNVLNKIPRGPIKEKKHR 212 >XP_009588252.1 PREDICTED: reticulon-like protein B9 [Nicotiana tomentosiformis] XP_016476843.1 PREDICTED: reticulon-like protein B9 [Nicotiana tabacum] Length = 220 Score = 81.6 bits (200), Expect = 1e-16 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKK 207 L TLP LYE+Y++EVDYL S+GN+D KKLY+KFD +VLNKIPRGPVK++K Sbjct: 169 LATLPALYERYQNEVDYLVSQGNQDMKKLYEKFDTEVLNKIPRGPVKQRK 218 >KYP75133.1 Reticulon-like protein B9 [Cajanus cajan] Length = 215 Score = 81.3 bits (199), Expect = 1e-16 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 L TLP +YE+YE EV+YLAS+GN+D K+L+ FD+KVLNKIPRGPVKEKK + Sbjct: 164 LVTLPIMYERYEHEVNYLASKGNQDVKRLFNTFDSKVLNKIPRGPVKEKKHK 215 >GAU14779.1 hypothetical protein TSUD_49910 [Trifolium subterraneum] Length = 178 Score = 80.1 bits (196), Expect = 2e-16 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = -2 Query: 356 LETLPFLYEKYESEVDYLASRGNRDAKKLYKKFDAKVLNKIPRGPVKEKKFR 201 L T+P +YE+YE EVDYLAS+GN+D K+L+ K D+ VLN+IPRGPVKEKK R Sbjct: 127 LVTVPIMYERYEHEVDYLASKGNQDVKRLFNKLDSTVLNRIPRGPVKEKKLR 178