BLASTX nr result
ID: Angelica27_contig00036649
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036649 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017218676.1 PREDICTED: K(+) efflux antiporter 2, chloroplasti... 62 5e-09 >XP_017218676.1 PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Daucus carota subsp. sativus] XP_017218678.1 PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Daucus carota subsp. sativus] KZM88068.1 hypothetical protein DCAR_025143 [Daucus carota subsp. sativus] Length = 1206 Score = 61.6 bits (148), Expect = 5e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 133 MVSVCSFQQPNGNVIGGRGVEGTSYRILESLNKHAQFSCEIYS 5 MVS+CSF+QPN +VIGG EGTSYRIL SLNK AQFSC ++S Sbjct: 1 MVSMCSFRQPNVSVIGGD--EGTSYRILGSLNKRAQFSCVVFS 41