BLASTX nr result
ID: Angelica27_contig00036531
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036531 (264 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM88578.1 hypothetical protein DCAR_025653 [Daucus carota subsp... 61 7e-09 XP_017219765.1 PREDICTED: dnaJ homolog subfamily C member 21-lik... 61 7e-09 >KZM88578.1 hypothetical protein DCAR_025653 [Daucus carota subsp. sativus] Length = 725 Score = 60.8 bits (146), Expect = 7e-09 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 105 LAKKFLRLCPQLDGTSDLITAFKILRSGTTKSTVD 1 LAKK LRLCP LDGTSDLITAFKILRSG STVD Sbjct: 34 LAKKSLRLCPHLDGTSDLITAFKILRSGAASSTVD 68 >XP_017219765.1 PREDICTED: dnaJ homolog subfamily C member 21-like [Daucus carota subsp. sativus] XP_017219787.1 PREDICTED: dnaJ homolog subfamily C member 21-like [Daucus carota subsp. sativus] KZM88579.1 hypothetical protein DCAR_025654 [Daucus carota subsp. sativus] Length = 788 Score = 60.8 bits (146), Expect = 7e-09 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 105 LAKKFLRLCPQLDGTSDLITAFKILRSGTTKSTVD 1 LAKK LRLCP LDGTSDLITAFKILRSG STVD Sbjct: 44 LAKKSLRLCPHLDGTSDLITAFKILRSGAASSTVD 78