BLASTX nr result
ID: Angelica27_contig00036491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036491 (208 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017234785.1 PREDICTED: mediator of RNA polymerase II transcri... 81 2e-16 XP_016732460.1 PREDICTED: mediator of RNA polymerase II transcri... 74 8e-14 KDP28624.1 hypothetical protein JCGZ_14395 [Jatropha curcas] 73 2e-13 XP_012083389.1 PREDICTED: mediator of RNA polymerase II transcri... 73 2e-13 KCW71609.1 hypothetical protein EUGRSUZ_E00136 [Eucalyptus grandis] 73 2e-13 EOX95958.1 Mediator of RNA polymerase II transcription subunit 1... 73 2e-13 XP_017637280.1 PREDICTED: mediator of RNA polymerase II transcri... 73 2e-13 XP_007051802.2 PREDICTED: mediator of RNA polymerase II transcri... 73 2e-13 EOX95959.1 Mediator of RNA polymerase II transcription subunit 1... 73 2e-13 EOX95957.1 Mediator of RNA polymerase II transcription subunit 1... 73 2e-13 XP_010055127.1 PREDICTED: mediator of RNA polymerase II transcri... 73 2e-13 KJB49480.1 hypothetical protein B456_008G121300 [Gossypium raimo... 72 3e-13 XP_012437707.1 PREDICTED: mediator of RNA polymerase II transcri... 72 3e-13 XP_018834307.1 PREDICTED: mediator of RNA polymerase II transcri... 72 4e-13 OAY49163.1 hypothetical protein MANES_05G034300 [Manihot esculen... 72 5e-13 OAY62288.1 hypothetical protein MANES_01G256700 [Manihot esculenta] 71 7e-13 XP_006445033.1 hypothetical protein CICLE_v10018441mg [Citrus cl... 71 7e-13 OMO78777.1 Mediator complex, subunit Med12 [Corchorus capsularis] 71 7e-13 XP_002511863.1 PREDICTED: mediator of RNA polymerase II transcri... 71 7e-13 XP_006445035.1 hypothetical protein CICLE_v10018441mg [Citrus cl... 71 7e-13 >XP_017234785.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Daucus carota subsp. sativus] KZN07771.1 hypothetical protein DCAR_008608 [Daucus carota subsp. sativus] Length = 2258 Score = 81.3 bits (199), Expect = 2e-16 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS 71 LQFLLRLLPLVCADR P RNMRYMLAAVIL LLG+RVVYED+DQS Sbjct: 1985 LQFLLRLLPLVCADRAPSGRNMRYMLAAVILHLLGSRVVYEDLDQS 2030 >XP_016732460.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Gossypium hirsutum] XP_016732461.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Gossypium hirsutum] XP_016732462.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Gossypium hirsutum] Length = 2251 Score = 73.9 bits (180), Expect = 8e-14 Identities = 34/46 (73%), Positives = 43/46 (93%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS 71 LQF++RLLP++CAD EP SRNMR+MLA+VILRLLG+RVV+ED+D S Sbjct: 1990 LQFIVRLLPIICADGEPSSRNMRHMLASVILRLLGSRVVHEDVDLS 2035 >KDP28624.1 hypothetical protein JCGZ_14395 [Jatropha curcas] Length = 1922 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSI 68 LQ LLRLLP++CAD EP RNMRYMLA+VILRLLG+RVV+ED D S+ Sbjct: 1651 LQLLLRLLPIICADGEPSGRNMRYMLASVILRLLGHRVVHEDADLSL 1697 >XP_012083389.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Jatropha curcas] Length = 2266 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSI 68 LQ LLRLLP++CAD EP RNMRYMLA+VILRLLG+RVV+ED D S+ Sbjct: 1995 LQLLLRLLPIICADGEPSGRNMRYMLASVILRLLGHRVVHEDADLSL 2041 >KCW71609.1 hypothetical protein EUGRSUZ_E00136 [Eucalyptus grandis] Length = 2139 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSI 68 L FLLRLLP++CADREPL RNMR+MLA+VILRLLGN++VY+ D +I Sbjct: 1993 LHFLLRLLPIICADREPLGRNMRHMLASVILRLLGNQLVYDYADLAI 2039 >EOX95958.1 Mediator of RNA polymerase II transcription subunit 12 isoform 2 [Theobroma cacao] Length = 2237 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS 71 LQF++RLLP++CAD EP +RNMR+MLA+VILRLLG+RVV+ED+D S Sbjct: 1992 LQFIVRLLPIICADGEPSTRNMRHMLASVILRLLGSRVVHEDVDLS 2037 >XP_017637280.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Gossypium arboreum] XP_017637281.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Gossypium arboreum] KHG17230.1 Putative mediator of RNA polymerase II transcription subunit 12 [Gossypium arboreum] Length = 2251 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS 71 LQF++RLLP++CAD EP SRN+R+MLA+VILRLLG+RVV+ED+D S Sbjct: 1990 LQFIVRLLPIICADGEPSSRNLRHMLASVILRLLGSRVVHEDVDLS 2035 >XP_007051802.2 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Theobroma cacao] XP_017980839.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Theobroma cacao] Length = 2257 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS 71 LQF++RLLP++CAD EP +RNMR+MLA+VILRLLG+RVV+ED+D S Sbjct: 1992 LQFIVRLLPIICADGEPSTRNMRHMLASVILRLLGSRVVHEDVDLS 2037 >EOX95959.1 Mediator of RNA polymerase II transcription subunit 12 isoform 3 [Theobroma cacao] Length = 2257 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS 71 LQF++RLLP++CAD EP +RNMR+MLA+VILRLLG+RVV+ED+D S Sbjct: 1992 LQFIVRLLPIICADGEPSTRNMRHMLASVILRLLGSRVVHEDVDLS 2037 >EOX95957.1 Mediator of RNA polymerase II transcription subunit 12 isoform 1 [Theobroma cacao] Length = 2261 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS 71 LQF++RLLP++CAD EP +RNMR+MLA+VILRLLG+RVV+ED+D S Sbjct: 1996 LQFIVRLLPIICADGEPSTRNMRHMLASVILRLLGSRVVHEDVDLS 2041 >XP_010055127.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 isoform X1 [Eucalyptus grandis] KCW71608.1 hypothetical protein EUGRSUZ_E00136 [Eucalyptus grandis] Length = 2270 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSI 68 L FLLRLLP++CADREPL RNMR+MLA+VILRLLGN++VY+ D +I Sbjct: 1993 LHFLLRLLPIICADREPLGRNMRHMLASVILRLLGNQLVYDYADLAI 2039 >KJB49480.1 hypothetical protein B456_008G121300 [Gossypium raimondii] Length = 2109 Score = 72.4 bits (176), Expect = 3e-13 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS 71 LQF++RLLP++CAD EP SRNMR+MLA+VI RLLG+RVV+ED+D S Sbjct: 1990 LQFIVRLLPIICADGEPSSRNMRHMLASVIFRLLGSRVVHEDVDLS 2035 >XP_012437707.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Gossypium raimondii] XP_012437708.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Gossypium raimondii] XP_012437709.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Gossypium raimondii] KJB49481.1 hypothetical protein B456_008G121300 [Gossypium raimondii] Length = 2251 Score = 72.4 bits (176), Expect = 3e-13 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS 71 LQF++RLLP++CAD EP SRNMR+MLA+VI RLLG+RVV+ED+D S Sbjct: 1990 LQFIVRLLPIICADGEPSSRNMRHMLASVIFRLLGSRVVHEDVDLS 2035 >XP_018834307.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834308.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834309.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834310.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834311.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834312.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834313.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834314.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834315.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834317.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834318.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] Length = 2266 Score = 72.0 bits (175), Expect = 4e-13 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSIFST 59 LQ LLR LP++CAD EP RNMR +LA +ILRLLGNRVVYED D S + T Sbjct: 1993 LQLLLRFLPIICADGEPSGRNMRQILAPIILRLLGNRVVYEDADLSFYQT 2042 >OAY49163.1 hypothetical protein MANES_05G034300 [Manihot esculenta] OAY49164.1 hypothetical protein MANES_05G034300 [Manihot esculenta] Length = 2265 Score = 71.6 bits (174), Expect = 5e-13 Identities = 41/72 (56%), Positives = 49/72 (68%), Gaps = 3/72 (4%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQS---IFSTLNXXXXX 38 LQ LLRLLP++C D EP RNMR+MLA+VILRLLGNRVV+ED D S + S+ + Sbjct: 1994 LQLLLRLLPIICTDGEPSGRNMRHMLASVILRLLGNRVVHEDADLSFSPVQSSQSKMDME 2053 Query: 37 XXXXXXSVDLSG 2 SVDLSG Sbjct: 2054 SLLEIVSVDLSG 2065 >OAY62288.1 hypothetical protein MANES_01G256700 [Manihot esculenta] Length = 2117 Score = 71.2 bits (173), Expect = 7e-13 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSIFSTL 56 LQ LLRLLP++C D EP RNMR+MLA+VILRLLGNRVV+ED D S FS L Sbjct: 1966 LQLLLRLLPIICTDGEPSGRNMRHMLASVILRLLGNRVVHEDADLS-FSPL 2015 >XP_006445033.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] XP_006445034.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] XP_006445038.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] XP_015389691.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 isoform X2 [Citrus sinensis] ESR58273.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] ESR58274.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] ESR58278.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] Length = 2239 Score = 71.2 bits (173), Expect = 7e-13 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSIFST 59 LQFLLRLLPL+ D EP RNMRY+LA+VILRLLG+RVV+ED D S + T Sbjct: 1964 LQFLLRLLPLIYTDGEPSGRNMRYLLASVILRLLGSRVVHEDADLSFYPT 2013 >OMO78777.1 Mediator complex, subunit Med12 [Corchorus capsularis] Length = 2258 Score = 71.2 bits (173), Expect = 7e-13 Identities = 32/47 (68%), Positives = 43/47 (91%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSI 68 LQ ++RLLP++CAD EP +RNMR+MLA+VILRLLG+RVV+ED+D S+ Sbjct: 1989 LQIIVRLLPIICADGEPSARNMRHMLASVILRLLGSRVVHEDVDLSL 2035 >XP_002511863.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Ricinus communis] XP_015584240.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Ricinus communis] XP_015584243.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Ricinus communis] EEF50532.1 CRP, putative [Ricinus communis] Length = 2264 Score = 71.2 bits (173), Expect = 7e-13 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSIF 65 LQ LLRLLP++C D EP RNMR+MLA VILRLLGNRVV+ED D S + Sbjct: 1994 LQLLLRLLPVICTDGEPSGRNMRHMLACVILRLLGNRVVHEDADLSFY 2041 >XP_006445035.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] XP_006445036.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] XP_006445037.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] XP_006491101.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 isoform X1 [Citrus sinensis] XP_006491102.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 isoform X1 [Citrus sinensis] XP_015389690.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 isoform X1 [Citrus sinensis] ESR58275.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] ESR58276.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] ESR58277.1 hypothetical protein CICLE_v10018441mg [Citrus clementina] Length = 2277 Score = 71.2 bits (173), Expect = 7e-13 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -1 Query: 208 LQFLLRLLPLVCADREPLSRNMRYMLAAVILRLLGNRVVYEDIDQSIFST 59 LQFLLRLLPL+ D EP RNMRY+LA+VILRLLG+RVV+ED D S + T Sbjct: 2002 LQFLLRLLPLIYTDGEPSGRNMRYLLASVILRLLGSRVVHEDADLSFYPT 2051