BLASTX nr result
ID: Angelica27_contig00036458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036458 (528 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006596016.1 PREDICTED: metallothionein-like protein 1 [Glycin... 53 2e-06 ACG42011.1 metallothionein-like protein type 2 [Zea mays] 52 4e-06 KHM99462.1 Metallothionein-like protein 1 [Glycine soja] KRH6609... 52 5e-06 ABQ44281.1 metallothionein type 2 [Sesbania drummondii] 52 6e-06 AQK90308.1 Metallothionein-like protein 2A [Zea mays] 52 6e-06 XP_008655633.1 PREDICTED: metallothionein-like protein 2A [Zea m... 52 6e-06 ACG30993.1 metallothionein-like protein type 2 [Zea mays] ACG349... 52 6e-06 ACG33278.1 metallothionein-like protein type 2 [Zea mays] 52 7e-06 AGV54716.1 type 2 metallothionein [Phaseolus vulgaris] 52 8e-06 BAP25845.1 metallothionein [Iris lactea var. lactea] 52 9e-06 >XP_006596016.1 PREDICTED: metallothionein-like protein 1 [Glycine max] ACU14602.1 unknown [Glycine max] KHN17215.1 Metallothionein-like protein 1 [Glycine soja] KRH15512.1 hypothetical protein GLYMA_14G093100 [Glycine max] Length = 75 Score = 53.1 bits (126), Expect = 2e-06 Identities = 21/39 (53%), Positives = 24/39 (61%) Frame = -2 Query: 401 LTLNLKSVRMGFVDENIATAGENGGCNCGSDCQCDPCNC 285 L L + SV+ + A ENGGCNCGS C CDPCNC Sbjct: 36 LVLGVGSVKAQLEGAEMGVAAENGGCNCGSSCTCDPCNC 74 >ACG42011.1 metallothionein-like protein type 2 [Zea mays] Length = 58 Score = 52.0 bits (123), Expect = 4e-06 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 350 ATAGENGGCNCGSDCQCDPCNCGK 279 A ENGGC CG +CQCDPCNCGK Sbjct: 35 AAGAENGGCKCGGNCQCDPCNCGK 58 >KHM99462.1 Metallothionein-like protein 1 [Glycine soja] KRH66094.1 hypothetical protein GLYMA_03G082100 [Glycine max] Length = 73 Score = 52.0 bits (123), Expect = 5e-06 Identities = 20/39 (51%), Positives = 25/39 (64%) Frame = -2 Query: 401 LTLNLKSVRMGFVDENIATAGENGGCNCGSDCQCDPCNC 285 L L + V+ F + A ENGGCNCGS+C CDPC+C Sbjct: 34 LVLGVGPVKAQFEGAEMGVAAENGGCNCGSNCTCDPCSC 72 >ABQ44281.1 metallothionein type 2 [Sesbania drummondii] Length = 79 Score = 52.0 bits (123), Expect = 6e-06 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = -2 Query: 401 LTLNLKSVRMGFVDENIATAGENGGCNCGSDCQCDPCNC 285 L + + V++ F + A ENGGC CGS+C CDPCNC Sbjct: 40 LVMGVAPVKVQFEGAEMGVAAENGGCKCGSNCPCDPCNC 78 >AQK90308.1 Metallothionein-like protein 2A [Zea mays] Length = 80 Score = 52.0 bits (123), Expect = 6e-06 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 350 ATAGENGGCNCGSDCQCDPCNCGK 279 A ENGGC CG +CQCDPCNCGK Sbjct: 57 AAGAENGGCKCGGNCQCDPCNCGK 80 >XP_008655633.1 PREDICTED: metallothionein-like protein 2A [Zea mays] ACF85243.1 unknown [Zea mays] ACG24365.1 metallothionein-like protein type 2 [Zea mays] ACG26963.1 metallothionein-like protein type 2 [Zea mays] ACG30718.1 metallothionein-like protein type 2 [Zea mays] ACG44655.1 metallothionein-like protein type 2 [Zea mays] AQK90307.1 Metallothionein-like protein 2A [Zea mays] Length = 82 Score = 52.0 bits (123), Expect = 6e-06 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 350 ATAGENGGCNCGSDCQCDPCNCGK 279 A ENGGC CG +CQCDPCNCGK Sbjct: 59 AAGAENGGCKCGGNCQCDPCNCGK 82 >ACG30993.1 metallothionein-like protein type 2 [Zea mays] ACG34992.1 metallothionein-like protein type 2 [Zea mays] ACG37736.1 metallothionein-like protein type 2 [Zea mays] ACG42127.1 metallothionein-like protein type 2 [Zea mays] Length = 83 Score = 52.0 bits (123), Expect = 6e-06 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 350 ATAGENGGCNCGSDCQCDPCNCGK 279 A ENGGC CG +CQCDPCNCGK Sbjct: 60 AAGAENGGCKCGGNCQCDPCNCGK 83 >ACG33278.1 metallothionein-like protein type 2 [Zea mays] Length = 84 Score = 52.0 bits (123), Expect = 7e-06 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 350 ATAGENGGCNCGSDCQCDPCNCGK 279 A ENGGC CG +CQCDPCNCGK Sbjct: 61 AAGAENGGCKCGGNCQCDPCNCGK 84 >AGV54716.1 type 2 metallothionein [Phaseolus vulgaris] Length = 79 Score = 51.6 bits (122), Expect = 8e-06 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = -2 Query: 401 LTLNLKSVRMGFVDENIATAGENGGCNCGSDCQCDPCNC 285 L + + V++ F + +GENGGC CG +CQCDPC C Sbjct: 40 LVMGVAPVKVQFEGAEMGVSGENGGCKCGDNCQCDPCTC 78 >BAP25845.1 metallothionein [Iris lactea var. lactea] Length = 82 Score = 51.6 bits (122), Expect = 9e-06 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 359 ENIATAGENGGCNCGSDCQCDPCNC 285 E++A A ENGGC CGS C CDPCNC Sbjct: 57 ESVAAAAENGGCKCGSSCTCDPCNC 81