BLASTX nr result
ID: Angelica27_contig00036266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036266 (534 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255548.1 PREDICTED: cytochrome b561 domain-containing prot... 108 8e-26 OMP05380.1 hypothetical protein COLO4_08895 [Corchorus olitorius] 81 6e-17 OMO95887.1 hypothetical protein CCACVL1_05200 [Corchorus capsula... 80 1e-16 XP_017239045.1 PREDICTED: cytochrome b561 domain-containing prot... 84 2e-16 XP_017239043.1 PREDICTED: cytochrome b561 domain-containing prot... 84 2e-16 XP_004144633.1 PREDICTED: cytochrome b561 domain-containing prot... 83 3e-16 XP_016746984.1 PREDICTED: cytochrome b561 domain-containing prot... 83 3e-16 XP_012488838.1 PREDICTED: cytochrome b561 domain-containing prot... 83 3e-16 XP_012488829.1 PREDICTED: cytochrome b561 domain-containing prot... 83 3e-16 XP_008465444.1 PREDICTED: cytochrome b561 domain-containing prot... 83 5e-16 XP_017626799.1 PREDICTED: cytochrome b561 domain-containing prot... 82 7e-16 XP_017626791.1 PREDICTED: cytochrome b561 domain-containing prot... 82 7e-16 XP_016746028.1 PREDICTED: cytochrome b561 domain-containing prot... 82 1e-15 XP_018856865.1 PREDICTED: cytochrome b561 domain-containing prot... 81 2e-15 XP_015880070.1 PREDICTED: cytochrome b561 domain-containing prot... 80 5e-15 XP_007048988.1 PREDICTED: cytochrome b561 domain-containing prot... 80 7e-15 XP_002300871.2 hypothetical protein POPTR_0002s05900g [Populus t... 78 2e-14 ONI17738.1 hypothetical protein PRUPE_3G176500 [Prunus persica] 78 3e-14 XP_016703862.1 PREDICTED: cytochrome b561 domain-containing prot... 77 4e-14 XP_012472363.1 PREDICTED: cytochrome b561 domain-containing prot... 77 4e-14 >XP_017255548.1 PREDICTED: cytochrome b561 domain-containing protein At4g18260-like [Daucus carota subsp. sativus] Length = 256 Score = 108 bits (270), Expect = 8e-26 Identities = 51/65 (78%), Positives = 58/65 (89%) Frame = +1 Query: 340 AYDQEHVRSTNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFY 519 AY QE V STN++SS+ML DIE+HG LLW+SMGFLMP+SILAIRMSNR+ESG K KFMFY Sbjct: 26 AYGQERVESTNKLSSEMLIDIEIHGLLLWASMGFLMPLSILAIRMSNRQESGGKFKFMFY 85 Query: 520 MHATL 534 MHATL Sbjct: 86 MHATL 90 >OMP05380.1 hypothetical protein COLO4_08895 [Corchorus olitorius] Length = 101 Score = 81.3 bits (199), Expect = 6e-17 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 8/68 (11%) Frame = +1 Query: 349 QEHVRST--------NEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKL 504 QEHV S ++VS +++F+I +HGFLLW+SMGFLMPV ILAIRM++REE G +L Sbjct: 29 QEHVESIGKNPNNSIHKVSHKLMFEITLHGFLLWASMGFLMPVGILAIRMTHREECGRRL 88 Query: 505 KFMFYMHA 528 K +FY+HA Sbjct: 89 KILFYVHA 96 >OMO95887.1 hypothetical protein CCACVL1_05200 [Corchorus capsularis] Length = 103 Score = 80.5 bits (197), Expect = 1e-16 Identities = 39/70 (55%), Positives = 52/70 (74%), Gaps = 10/70 (14%) Frame = +1 Query: 349 QEHVRST----------NEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGT 498 QEHV S ++VS +++F+I +HGFLLW+SMGFLMPV ILAIRM++REE G Sbjct: 29 QEHVESIGKNANNKDSIHKVSHKLMFEITLHGFLLWASMGFLMPVGILAIRMTHREECGR 88 Query: 499 KLKFMFYMHA 528 +LK +FY+HA Sbjct: 89 RLKILFYVHA 98 >XP_017239045.1 PREDICTED: cytochrome b561 domain-containing protein At4g18260-like isoform X2 [Daucus carota subsp. sativus] Length = 261 Score = 84.0 bits (206), Expect = 2e-16 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +1 Query: 367 TNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMHATL 534 +N++S QM+ DI VHGFLLW+SMGFLMPV IL IRM N E+SG +LK MFY HATL Sbjct: 44 SNKLSPQMVSDITVHGFLLWTSMGFLMPVGILVIRMMNTEQSGKRLKIMFYTHATL 99 >XP_017239043.1 PREDICTED: cytochrome b561 domain-containing protein At4g18260-like isoform X1 [Daucus carota subsp. sativus] XP_017239044.1 PREDICTED: cytochrome b561 domain-containing protein At4g18260-like isoform X1 [Daucus carota subsp. sativus] KZN01060.1 hypothetical protein DCAR_009814 [Daucus carota subsp. sativus] Length = 265 Score = 84.0 bits (206), Expect = 2e-16 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +1 Query: 367 TNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMHATL 534 +N++S QM+ DI VHGFLLW+SMGFLMPV IL IRM N E+SG +LK MFY HATL Sbjct: 44 SNKLSPQMVSDITVHGFLLWTSMGFLMPVGILVIRMMNTEQSGKRLKIMFYTHATL 99 >XP_004144633.1 PREDICTED: cytochrome b561 domain-containing protein At4g18260 [Cucumis sativus] KGN54933.1 hypothetical protein Csa_4G608090 [Cucumis sativus] Length = 254 Score = 83.2 bits (204), Expect = 3e-16 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = +1 Query: 364 STNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMHATL 534 ++ ++SS +LFDI +HGFLLW+SMGFLMPV IL IRMSNRE+ G KLK+ FY+H L Sbjct: 50 NSQKMSSSLLFDITLHGFLLWASMGFLMPVGILVIRMSNREQCGRKLKYYFYIHTIL 106 >XP_016746984.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like [Gossypium hirsutum] Length = 255 Score = 83.2 bits (204), Expect = 3e-16 Identities = 36/54 (66%), Positives = 48/54 (88%) Frame = +1 Query: 364 STNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMH 525 S ++VS +++F+I +HGFLLW+SMGFLMPV ILAIRMSNR+E GT+LK +FY+H Sbjct: 46 SIHKVSHKLMFEIRLHGFLLWASMGFLMPVGILAIRMSNRQECGTRLKILFYVH 99 >XP_012488838.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like isoform X2 [Gossypium raimondii] KJB06945.1 hypothetical protein B456_001G211700 [Gossypium raimondii] KJB06946.1 hypothetical protein B456_001G211700 [Gossypium raimondii] Length = 255 Score = 83.2 bits (204), Expect = 3e-16 Identities = 36/54 (66%), Positives = 48/54 (88%) Frame = +1 Query: 364 STNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMH 525 S ++VS +++F+I +HGFLLW+SMGFLMPV ILAIRMSNR+E GT+LK +FY+H Sbjct: 46 SIHKVSHKLMFEIRLHGFLLWASMGFLMPVGILAIRMSNRQECGTRLKILFYVH 99 >XP_012488829.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like isoform X1 [Gossypium raimondii] Length = 256 Score = 83.2 bits (204), Expect = 3e-16 Identities = 36/54 (66%), Positives = 48/54 (88%) Frame = +1 Query: 364 STNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMH 525 S ++VS +++F+I +HGFLLW+SMGFLMPV ILAIRMSNR+E GT+LK +FY+H Sbjct: 46 SIHKVSHKLMFEIRLHGFLLWASMGFLMPVGILAIRMSNRQECGTRLKILFYVH 99 >XP_008465444.1 PREDICTED: cytochrome b561 domain-containing protein At4g18260-like [Cucumis melo] Length = 254 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/57 (63%), Positives = 47/57 (82%) Frame = +1 Query: 364 STNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMHATL 534 ++ ++SS +LFDI +HGFLLW+SMGFLMP+ IL IRMSNRE+ G KLK+ FY+H L Sbjct: 50 NSQKMSSSLLFDITLHGFLLWASMGFLMPIGILVIRMSNREQCGRKLKYYFYIHTIL 106 >XP_017626799.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like isoform X2 [Gossypium arboreum] Length = 237 Score = 82.0 bits (201), Expect = 7e-16 Identities = 35/54 (64%), Positives = 48/54 (88%) Frame = +1 Query: 364 STNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMH 525 S ++VS +++F+I +HGFLLW+SMGFLMP+ ILAIRMSNR+E GT+LK +FY+H Sbjct: 46 SIHKVSHKLMFEIRLHGFLLWASMGFLMPLGILAIRMSNRQECGTRLKILFYVH 99 >XP_017626791.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like isoform X1 [Gossypium arboreum] Length = 238 Score = 82.0 bits (201), Expect = 7e-16 Identities = 35/54 (64%), Positives = 48/54 (88%) Frame = +1 Query: 364 STNEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMH 525 S ++VS +++F+I +HGFLLW+SMGFLMP+ ILAIRMSNR+E GT+LK +FY+H Sbjct: 46 SIHKVSHKLMFEIRLHGFLLWASMGFLMPLGILAIRMSNRQECGTRLKILFYVH 99 >XP_016746028.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like [Gossypium hirsutum] Length = 255 Score = 81.6 bits (200), Expect = 1e-15 Identities = 38/69 (55%), Positives = 53/69 (76%), Gaps = 10/69 (14%) Frame = +1 Query: 349 QEHVRSTN----------EVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGT 498 Q+HV+S + +VS +++F+I +HGFLLW+S+GFLMPV ILAIRMSNR+E GT Sbjct: 31 QQHVKSIDSIADKKDGIHKVSHKLMFEIRLHGFLLWASIGFLMPVGILAIRMSNRQECGT 90 Query: 499 KLKFMFYMH 525 +LK +FY+H Sbjct: 91 RLKILFYVH 99 >XP_018856865.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like [Juglans regia] Length = 248 Score = 80.9 bits (198), Expect = 2e-15 Identities = 36/55 (65%), Positives = 47/55 (85%) Frame = +1 Query: 370 NEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMHATL 534 +++S + LF+I +HGFLLW+SMGFLMPV IL IRMSNREESG +L+ +FY+HA L Sbjct: 41 DKLSPKFLFEITLHGFLLWASMGFLMPVGILIIRMSNREESGRRLRILFYVHAIL 95 >XP_015880070.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like [Ziziphus jujuba] Length = 255 Score = 80.1 bits (196), Expect = 5e-15 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 10/70 (14%) Frame = +1 Query: 349 QEHVRSTN----------EVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGT 498 QEHV+ST E+S +++F+I +HGFLLW+SMG LMP+ IL IRMSNR E G Sbjct: 29 QEHVKSTGGQTSKNDNPRELSHKLMFEITLHGFLLWASMGLLMPIGILTIRMSNRAECGR 88 Query: 499 KLKFMFYMHA 528 +LK +FY+HA Sbjct: 89 RLKILFYIHA 98 >XP_007048988.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890 [Theobroma cacao] EOX93145.1 Cytochrome b561/ferric reductase transmembrane family protein, putative [Theobroma cacao] Length = 254 Score = 79.7 bits (195), Expect = 7e-15 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +1 Query: 379 SSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMHA 528 S +++F+I +HGFLLW+SMGFLMPV ILAIRMSNREE G +LK +FY+HA Sbjct: 50 SHKLMFEITLHGFLLWASMGFLMPVGILAIRMSNREECGRRLKILFYVHA 99 >XP_002300871.2 hypothetical protein POPTR_0002s05900g [Populus trichocarpa] EEE80144.2 hypothetical protein POPTR_0002s05900g [Populus trichocarpa] Length = 251 Score = 78.2 bits (191), Expect = 2e-14 Identities = 35/70 (50%), Positives = 53/70 (75%), Gaps = 10/70 (14%) Frame = +1 Query: 349 QEHVRST----------NEVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGT 498 QEH+++T +++S ++LF+I +HGFLLW+SMGFLMPV ++AIRMS+RE G Sbjct: 29 QEHLKTTGNLTSNKNIIHKISPKLLFEITLHGFLLWASMGFLMPVGVIAIRMSHREACGR 88 Query: 499 KLKFMFYMHA 528 +LK +FY+H+ Sbjct: 89 RLKILFYVHS 98 >ONI17738.1 hypothetical protein PRUPE_3G176500 [Prunus persica] Length = 252 Score = 77.8 bits (190), Expect = 3e-14 Identities = 36/67 (53%), Positives = 50/67 (74%), Gaps = 8/67 (11%) Frame = +1 Query: 349 QEHVRSTN--------EVSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKL 504 QEH + + E+S ++LF+I +HGFLLW+SMGFLMP+ ILAIRMS+REE G +L Sbjct: 29 QEHTKGASSHKDNNIHEMSHKLLFEITLHGFLLWASMGFLMPLGILAIRMSHREECGRRL 88 Query: 505 KFMFYMH 525 + +FY+H Sbjct: 89 RILFYVH 95 >XP_016703862.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like [Gossypium hirsutum] XP_017642586.1 PREDICTED: cytochrome b561 domain-containing protein At2g30890-like [Gossypium arboreum] Length = 233 Score = 77.4 bits (189), Expect = 4e-14 Identities = 33/51 (64%), Positives = 44/51 (86%) Frame = +1 Query: 376 VSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMHA 528 +S +++F+I +HGFLLW+SMGFLMP+ ILAIRMSN EE G KL+ +FY+HA Sbjct: 37 ISHKLMFEITLHGFLLWASMGFLMPIGILAIRMSNGEECGRKLQILFYVHA 87 >XP_012472363.1 PREDICTED: cytochrome b561 domain-containing protein At4g18260-like isoform X2 [Gossypium raimondii] KJB08585.1 hypothetical protein B456_001G092200 [Gossypium raimondii] Length = 233 Score = 77.4 bits (189), Expect = 4e-14 Identities = 33/51 (64%), Positives = 44/51 (86%) Frame = +1 Query: 376 VSSQMLFDIEVHGFLLWSSMGFLMPVSILAIRMSNREESGTKLKFMFYMHA 528 +S +++F+I +HGFLLW+SMGFLMP+ ILAIRMSN EE G KL+ +FY+HA Sbjct: 37 ISHKLMFEITLHGFLLWASMGFLMPIGILAIRMSNGEECGRKLQILFYVHA 87