BLASTX nr result
ID: Angelica27_contig00036186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00036186 (243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017240715.1 PREDICTED: uncharacterized protein LOC108213435 [... 52 7e-06 >XP_017240715.1 PREDICTED: uncharacterized protein LOC108213435 [Daucus carota subsp. sativus] XP_017240716.1 PREDICTED: uncharacterized protein LOC108213435 [Daucus carota subsp. sativus] KZN01909.1 hypothetical protein DCAR_010663 [Daucus carota subsp. sativus] Length = 705 Score = 52.0 bits (123), Expect = 7e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 3 EQRLKSTSPEIQKSNSELGVIHGSVAVTSAASPSEVKSARS 125 +Q LK T P QKS+SE G+IHGSVAVTSA PSE +AR+ Sbjct: 45 DQVLKGTFPASQKSHSEFGIIHGSVAVTSADGPSEAGNARA 85