BLASTX nr result
ID: Angelica27_contig00035493
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035493 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249118.1 PREDICTED: regulator of telomere elongation helic... 97 1e-21 XP_017249117.1 PREDICTED: regulator of telomere elongation helic... 97 1e-21 >XP_017249118.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X2 [Daucus carota subsp. sativus] Length = 821 Score = 96.7 bits (239), Expect = 1e-21 Identities = 51/83 (61%), Positives = 59/83 (71%) Frame = -1 Query: 250 STLLQLSHTEDYPSFNENVKRQDSIKSAENVKRQDSIKSMDKLFNSFLVPMGTTKDPTCS 71 STLLQ SHTED+ + S ENVKRQD++K MDKLFNSFLVPMGTTKDPTCS Sbjct: 535 STLLQNSHTEDH------------LSSKENVKRQDNLKPMDKLFNSFLVPMGTTKDPTCS 582 Query: 70 ESSSTLTDLMTQNFPDQVREPAP 2 E S++LT+ TQNF Q+R P Sbjct: 583 EPSTSLTESKTQNFSAQIRVIPP 605 >XP_017249117.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X1 [Daucus carota subsp. sativus] KZM92977.1 hypothetical protein DCAR_016222 [Daucus carota subsp. sativus] Length = 1014 Score = 96.7 bits (239), Expect = 1e-21 Identities = 51/83 (61%), Positives = 59/83 (71%) Frame = -1 Query: 250 STLLQLSHTEDYPSFNENVKRQDSIKSAENVKRQDSIKSMDKLFNSFLVPMGTTKDPTCS 71 STLLQ SHTED+ + S ENVKRQD++K MDKLFNSFLVPMGTTKDPTCS Sbjct: 728 STLLQNSHTEDH------------LSSKENVKRQDNLKPMDKLFNSFLVPMGTTKDPTCS 775 Query: 70 ESSSTLTDLMTQNFPDQVREPAP 2 E S++LT+ TQNF Q+R P Sbjct: 776 EPSTSLTESKTQNFSAQIRVIPP 798