BLASTX nr result
ID: Angelica27_contig00035260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035260 (567 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017245681.1 PREDICTED: auxin response factor 17-like [Daucus ... 75 2e-12 >XP_017245681.1 PREDICTED: auxin response factor 17-like [Daucus carota subsp. sativus] KZM98360.1 hypothetical protein DCAR_014278 [Daucus carota subsp. sativus] Length = 519 Score = 75.1 bits (183), Expect = 2e-12 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 2/83 (2%) Frame = +2 Query: 5 PLHRELEMVNLHEGNVKISEDMGLLPHGDGEVFPVKGSQGARSDQI*--FNPLLMKFSSY 178 PLHRE ++ G+ +I ED GLLP DGE+FPV S + ++ NPLLM SY Sbjct: 368 PLHREGAVI---PGDGEIFEDAGLLPGRDGELFPVTRSSSSVAEPFNADLNPLLMNAGSY 424 Query: 179 PTGVQGARPDQICASSVYNFIHE 247 P G+QGAR D IC S + NF HE Sbjct: 425 PGGIQGARQDHICVSGISNFFHE 447