BLASTX nr result
ID: Angelica27_contig00035256
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035256 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235628.1 PREDICTED: MATH and LRR domain-containing protein... 100 3e-22 >XP_017235628.1 PREDICTED: MATH and LRR domain-containing protein PFE0570w [Daucus carota subsp. sativus] KZN05792.1 hypothetical protein DCAR_006629 [Daucus carota subsp. sativus] Length = 868 Score = 100 bits (248), Expect = 3e-22 Identities = 55/92 (59%), Positives = 64/92 (69%), Gaps = 6/92 (6%) Frame = -1 Query: 258 MNNPSQSENPDPHSTR---HQF---QNPISFDPQNNPQTLEISTIQNPQKPDPTRLVADX 97 MNNPSQSENPDP+ST+ HQF QNPIS D +NNPQT E+ +Q+PQK DPT+L Sbjct: 1 MNNPSQSENPDPYSTQLQQHQFPQSQNPISSDHENNPQTPEVPILQSPQKSDPTQLDEGQ 60 Query: 96 XXXXXXXESSGMVQESATKLPNRRNFNKRKKA 1 E SGMV +S TKL NRRN N+RKKA Sbjct: 61 EEREEEEECSGMVYKSNTKLANRRNLNRRKKA 92