BLASTX nr result
ID: Angelica27_contig00035050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035050 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017258457.1 PREDICTED: pentatricopeptide repeat-containing pr... 207 4e-65 XP_017258456.1 PREDICTED: pentatricopeptide repeat-containing pr... 212 5e-63 KVH94635.1 Pentatricopeptide repeat-containing protein [Cynara c... 144 9e-38 XP_016508294.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 2e-36 XP_016486327.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 1e-35 XP_009765478.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 1e-35 XP_009596309.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 1e-35 XP_019254099.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 1e-34 XP_004249810.1 PREDICTED: pentatricopeptide repeat-containing pr... 129 2e-32 XP_006339048.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 4e-32 XP_015089337.1 PREDICTED: pentatricopeptide repeat-containing pr... 127 5e-32 XP_010257116.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 1e-31 XP_016543309.1 PREDICTED: pentatricopeptide repeat-containing pr... 123 2e-30 JAT66509.1 Pentatricopeptide repeat-containing protein At1g08070... 115 1e-28 XP_011627497.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 9e-27 XP_016512063.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 4e-26 KNA11083.1 hypothetical protein SOVF_137930, partial [Spinacia o... 110 6e-26 XP_009771244.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 1e-25 KGN58246.1 hypothetical protein Csa_3G598920 [Cucumis sativus] 107 1e-25 XP_016511036.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 4e-25 >XP_017258457.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Daucus carota subsp. sativus] Length = 272 Score = 207 bits (526), Expect = 4e-65 Identities = 95/114 (83%), Positives = 106/114 (92%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPFVIRACNDL EQCRGKC HGEVLKVGLE+DVFVGTSLIEFYSGFESM+YAY+VF+E Sbjct: 107 FTYPFVIRACNDLWEQCRGKCAHGEVLKVGLELDVFVGTSLIEFYSGFESMQYAYRVFEE 166 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNV 9 +VVKDMV WT IL+GF+S FGD+ERGRELF RMPN+D+VVWNIMINGYV+ NV Sbjct: 167 MVVKDMVAWTAILHGFLSKFGDIERGRELFCRMPNKDMVVWNIMINGYVRVWNV 220 >XP_017258456.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] Length = 673 Score = 212 bits (539), Expect = 5e-63 Identities = 97/116 (83%), Positives = 108/116 (93%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPFVIRACNDL EQCRGKC HGEVLKVGLE+DVFVGTSLIEFYSGFESM YAY+VF+E Sbjct: 107 FTYPFVIRACNDLWEQCRGKCAHGEVLKVGLELDVFVGTSLIEFYSGFESMEYAYRVFEE 166 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVDD 3 +VVKDMV WT IL+GFVS FGD+ERGRELF RMPN+D+VVW+IMINGYV+ GNV+D Sbjct: 167 MVVKDMVAWTAILHGFVSKFGDIERGRELFCRMPNKDMVVWDIMINGYVRVGNVED 222 >KVH94635.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 677 Score = 144 bits (362), Expect = 9e-38 Identities = 67/114 (58%), Positives = 86/114 (75%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FT+PFVIRAC +L++ RG C+HG VLKVGLE+D FVGTSLI FY GF + A VFDE Sbjct: 111 FTFPFVIRACAELMDHLRGLCIHGLVLKVGLELDTFVGTSLIGFYGGFGDTKAARHVFDE 170 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNV 9 + +KD V WT +L V+ D+E R+LF++MPN+DLVVWNIMI Y+K+G+V Sbjct: 171 MPMKDKVAWTVLLSSCVNKCSDLEDARKLFDQMPNKDLVVWNIMIFQYIKSGDV 224 >XP_016508294.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Nicotiana tabacum] Length = 680 Score = 140 bits (353), Expect = 2e-36 Identities = 63/115 (54%), Positives = 88/115 (76%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPFVIRAC+DLLE +G +HG++ K+G+ D+FVGTSLIEFY+G +M KVF+E Sbjct: 114 FTYPFVIRACSDLLEFAKGLSLHGQLFKIGVHFDIFVGTSLIEFYTGMGNMSMTKKVFEE 173 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 L VKD V W +L +V+ F DME+ R+LF ++P +DLV+W+ +I GYVKAG+++ Sbjct: 174 LPVKDEVTWYAMLSCYVNKFNDMEKARDLFEKIPCKDLVIWHTIILGYVKAGDLE 228 >XP_016486327.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Nicotiana tabacum] Length = 673 Score = 138 bits (347), Expect = 1e-35 Identities = 61/115 (53%), Positives = 86/115 (74%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPFVIRAC+DLLE +G +HG++ K+G+ +D+FVGTSLIEFY+ M KVF+E Sbjct: 114 FTYPFVIRACSDLLEFAKGLSLHGQLFKIGVHLDIFVGTSLIEFYTAMGDMSMTKKVFEE 173 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 L VKD V W +L +V+ F DME+ R+LF ++P +DLV+W+ +I GYVK G+++ Sbjct: 174 LPVKDEVTWYAMLSSYVNKFNDMEKARDLFEKIPCKDLVIWHTIILGYVKVGDLE 228 >XP_009765478.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Nicotiana sylvestris] Length = 680 Score = 138 bits (347), Expect = 1e-35 Identities = 61/115 (53%), Positives = 86/115 (74%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPFVIRAC+DLLE +G +HG++ K+G+ +D+FVGTSLIEFY+ M KVF+E Sbjct: 114 FTYPFVIRACSDLLEFAKGLSLHGQLFKIGVHLDIFVGTSLIEFYTAMGDMSMTKKVFEE 173 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 L VKD V W +L +V+ F DME+ R+LF ++P +DLV+W+ +I GYVK G+++ Sbjct: 174 LPVKDEVTWYAMLSSYVNKFNDMEKARDLFEKIPCKDLVIWHTIILGYVKVGDLE 228 >XP_009596309.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Nicotiana tomentosiformis] Length = 680 Score = 138 bits (347), Expect = 1e-35 Identities = 62/115 (53%), Positives = 87/115 (75%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPFVIRAC+DLLE +G +HG++ K+G+ D+FVGTSLIEFY+ +M KVF+E Sbjct: 114 FTYPFVIRACSDLLEFAKGLSLHGQLFKIGVHFDIFVGTSLIEFYTAMGNMSMTKKVFEE 173 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 L VKD V W +L +V+ F DME+ R+LF ++P +DLV+W+ +I GYVKAG+++ Sbjct: 174 LPVKDEVTWYAMLSCYVNKFNDMEKARDLFEKIPCKDLVIWHTIILGYVKAGDLE 228 >XP_019254099.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Nicotiana attenuata] OIS97404.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 680 Score = 135 bits (340), Expect = 1e-34 Identities = 60/115 (52%), Positives = 86/115 (74%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPFVIRAC+DLL+ +G +HG++ K+G+ +D+FVGTSLIEFY+ M KVF+E Sbjct: 114 FTYPFVIRACSDLLQFAKGLSLHGQLFKIGVHLDIFVGTSLIEFYTAMGDMSMTKKVFEE 173 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 L VKD V W +L +V+ DME+ R+LF ++P +DLV+W+ +I GYVKAG+++ Sbjct: 174 LPVKDEVTWYAMLSSYVNKCNDMEKARDLFEKIPCKDLVIWHTIILGYVKAGDLE 228 >XP_004249810.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum lycopersicum] Length = 676 Score = 129 bits (323), Expect = 2e-32 Identities = 55/115 (47%), Positives = 83/115 (72%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPF IRAC+ LLE +G +HG+V+K+G+ DVFVGTSL++FY+ + +VF+E Sbjct: 110 FTYPFAIRACSGLLECAKGVSLHGQVVKIGVNFDVFVGTSLVDFYTAMGDLNMTKRVFEE 169 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 L KD + W +L +V+ F DM + R+LF ++P +DLV+W+ +I GYVKAG+++ Sbjct: 170 LPEKDEITWYAMLSSYVNKFNDMRKARDLFEKIPCKDLVIWHTLILGYVKAGDLE 224 >XP_006339048.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum tuberosum] Length = 680 Score = 128 bits (321), Expect = 4e-32 Identities = 56/115 (48%), Positives = 83/115 (72%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPF IRAC+ LLE +G +HG+V+K+G+ DVFVGTSL++FY+ + +VF+E Sbjct: 114 FTYPFTIRACSGLLEFAKGASLHGQVVKIGVNFDVFVGTSLVDFYTAMGDLNMTKQVFEE 173 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 L KD V W +L +V+ F DM + R+LF ++P +DLV+W+ +I GYVKAG+++ Sbjct: 174 LPDKDEVTWYAMLSSYVNKFNDMGKARDLFEKIPCKDLVIWHTLILGYVKAGDLE 228 >XP_015089337.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum pennellii] Length = 676 Score = 127 bits (320), Expect = 5e-32 Identities = 56/115 (48%), Positives = 82/115 (71%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPF IRAC+ LLE RG HG+V+K+G+ DVFVGTSL++FY+ + +VF+E Sbjct: 110 FTYPFAIRACSGLLEFPRGASFHGQVVKIGVNFDVFVGTSLVDFYTAMGDLNMTKRVFEE 169 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 L KD + W +L +V+ F DM + R+LF ++P +DLV+W+ +I GYVKAG+++ Sbjct: 170 LPEKDEITWYAMLSSYVNKFNDMGKARDLFEKIPCKDLVIWHTLILGYVKAGDLE 224 >XP_010257116.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Nelumbo nucifera] Length = 685 Score = 126 bits (317), Expect = 1e-31 Identities = 59/115 (51%), Positives = 82/115 (71%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FT+PFVIRAC +L G+CVH ++ K+ L DVF+ TSLIEFY M A +VFDE Sbjct: 119 FTFPFVIRACANLQYFRTGRCVHAQLFKICLHDDVFIATSLIEFYGISWDMMTAQQVFDE 178 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 + VKD V WTT+L G+V++ D+++ R+LF+ MP +DLV WN +I GYVK G+++ Sbjct: 179 MPVKDSVSWTTLLSGYVNHCSDLKKARQLFDEMPAKDLVAWNTIIGGYVKVGDME 233 >XP_016543309.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Capsicum annuum] XP_016543310.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Capsicum annuum] XP_016543311.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Capsicum annuum] Length = 680 Score = 123 bits (308), Expect = 2e-30 Identities = 57/115 (49%), Positives = 81/115 (70%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FTYPFVIRAC+DL E +GK HG+V K+G+ +DVFVGT LIEFY+ + +VF+ Sbjct: 114 FTYPFVIRACSDLHEFEKGKSFHGQVFKIGVNLDVFVGTKLIEFYTTMGDLNMTKRVFEG 173 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 + KD V W T+L +V+ F DM + R+LF ++P +D+V+W+ MI G VKAG ++ Sbjct: 174 MKDKDEVTWYTMLSSYVNIFNDMGKARDLFEKIPCKDVVIWHTMILGCVKAGELE 228 >JAT66509.1 Pentatricopeptide repeat-containing protein At1g08070, partial [Anthurium amnicola] Length = 360 Score = 115 bits (289), Expect = 1e-28 Identities = 57/114 (50%), Positives = 74/114 (64%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FT+ I+AC DL RG+ VHG++LK L D VG+ LIEFYS +R A +VFDE Sbjct: 119 FTFLNAIKACADLKHHLRGRWVHGQLLKTSLGRDACVGSCLIEFYSACGDIRGARQVFDE 178 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNV 9 + +KD V WT + G V++ G ME R LF MP +DLVVW IM+ GYVK G++ Sbjct: 179 MPLKDAVSWTVAISGHVNSSGGMESARNLFEEMPMKDLVVWTIMVGGYVKIGDM 232 >XP_011627497.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Amborella trichopoda] Length = 577 Score = 112 bits (281), Expect = 9e-27 Identities = 53/114 (46%), Positives = 78/114 (68%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FT PF+ RAC +L G+ VHG+ ++GL+ DVFV TSLIE Y G E + A +VFDE Sbjct: 11 FTLPFMARACVELSNLGLGQVVHGQAARLGLDADVFVQTSLIELYMGCECVPEARQVFDE 70 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNV 9 + +D+V WT I+ G+V+ DM +LF MP++D+V WNI+I+G++K G++ Sbjct: 71 MPKRDVVAWTAIISGYVNKCRDMGVACQLFEEMPDKDVVCWNIVISGFIKIGDM 124 >XP_016512063.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like, partial [Nicotiana tabacum] Length = 661 Score = 111 bits (277), Expect = 4e-26 Identities = 50/114 (43%), Positives = 81/114 (71%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FT+P V+++C LL G+ VH VLK G + FVGT+LI+ YSG ++ AY+VF+E Sbjct: 169 FTFPMVLKSCVKLLALVEGEEVHAVVLKAGFLSNSFVGTTLIDMYSGVGRVKCAYRVFNE 228 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNV 9 +V++++ WT+++ G+V+N GD+ GR LF+ P RD+V+WN M+ GY++ G++ Sbjct: 229 MVLRNVFTWTSMINGYVAN-GDLASGRMLFDLAPERDVVLWNRMVTGYIECGDM 281 >KNA11083.1 hypothetical protein SOVF_137930, partial [Spinacia oleracea] Length = 550 Score = 110 bits (275), Expect = 6e-26 Identities = 48/115 (41%), Positives = 81/115 (70%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 +T+P ++++C L C G+ VH VLK G ++FVG +LIE YSG + +AYKVF E Sbjct: 68 YTFPMILKSCGKLSALCEGEQVHSLVLKKGFRTNLFVGNTLIEMYSGSGEVGHAYKVFCE 127 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNVD 6 + ++++V WT ++ GF+S GD++ RE+F+ + RD+V+WN MI+GY++ G+++ Sbjct: 128 MTLRNVVAWTCMINGFIS-CGDVKSAREIFDLVVERDVVLWNTMISGYIEIGDME 181 Score = 63.5 bits (153), Expect = 2e-09 Identities = 32/88 (36%), Positives = 51/88 (57%) Frame = -2 Query: 278 EVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDELVVKDMVVWTTILYGFVSNFGDME 99 E+ + +E DV + ++I Y M A+K+FDE+ KD ++W T+L G+ +N G++E Sbjct: 154 EIFDLVVERDVVLWNTMISGYIEIGDMESAHKLFDEITCKDTMLWNTMLNGY-ANSGNIE 212 Query: 98 RGRELFNRMPNRDLVVWNIMINGYVKAG 15 ELF MP R++ WN +I Y G Sbjct: 213 ACEELFEVMPKRNVFSWNGLIGVYANYG 240 >XP_009771244.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230, partial [Nicotiana sylvestris] Length = 659 Score = 110 bits (274), Expect = 1e-25 Identities = 50/114 (43%), Positives = 80/114 (70%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FT+P V+++C LL G+ VH VLK G + FVGT+LI+ YSG ++ AY+VF+E Sbjct: 167 FTFPMVLKSCVKLLALVEGEEVHAVVLKAGFLSNSFVGTTLIDMYSGVGRVKCAYRVFNE 226 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNV 9 +V++++ WT+++ G+V N GD+ GR LF+ P RD+V+WN M+ GY++ G++ Sbjct: 227 MVLRNVFTWTSMINGYVVN-GDLASGRMLFDLAPERDVVLWNRMVTGYIECGDM 279 >KGN58246.1 hypothetical protein Csa_3G598920 [Cucumis sativus] Length = 315 Score = 107 bits (266), Expect = 1e-25 Identities = 48/110 (43%), Positives = 76/110 (69%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FT+PFVI+AC + L GK VHG ++K G DVFV +LI+FY R+A KVF++ Sbjct: 16 FTFPFVIKACTNFLSIDLGKVVHGSLIKYGFSGDVFVQNNLIDFYFKCGHTRFALKVFEK 75 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVK 21 + V+++V WTT++ G +S GD++ R +F+ +P++++V W MINGY++ Sbjct: 76 MRVRNVVSWTTVISGLIS-CGDLQEARRIFDEIPSKNVVSWTAMINGYIR 124 >XP_016511036.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Nicotiana tabacum] XP_016511037.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Nicotiana tabacum] Length = 549 Score = 108 bits (269), Expect = 4e-25 Identities = 49/114 (42%), Positives = 80/114 (70%) Frame = -2 Query: 350 FTYPFVIRACNDLLEQCRGKCVHGEVLKVGLEMDVFVGTSLIEFYSGFESMRYAYKVFDE 171 FT+P V+++C LL G+ VH VLKVG + FVGT+LI+ YS ++ AY+VF+E Sbjct: 57 FTFPMVLKSCVKLLALVEGEEVHAVVLKVGFLSNSFVGTTLIDMYSSVGRVKCAYRVFNE 116 Query: 170 LVVKDMVVWTTILYGFVSNFGDMERGRELFNRMPNRDLVVWNIMINGYVKAGNV 9 +V++++ WT+++ G+V+N GD+ R LF+ P RD+V+WN M+ GY++ G++ Sbjct: 117 MVLRNVFTWTSMINGYVAN-GDLASARMLFDLAPERDVVLWNRMVTGYIECGDM 169