BLASTX nr result
ID: Angelica27_contig00035035
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00035035 (526 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN09403.1 hypothetical protein DCAR_002059 [Daucus carota subsp... 57 7e-08 >KZN09403.1 hypothetical protein DCAR_002059 [Daucus carota subsp. sativus] Length = 61 Score = 56.6 bits (135), Expect = 7e-08 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = +3 Query: 117 LLFLFV-AVAYITVTAAQDMDFAPAPGPMVGMQSAATYPVSG-AVASVSLFVALLW 278 ++F FV VA +T A Q++D APAP P M SAA+YP +G AVA VS+FVALLW Sbjct: 7 IIFFFVFVVACMTAAAGQELDLAPAPAP--SMDSAASYPAAGAAVAFVSMFVALLW 60