BLASTX nr result
ID: Angelica27_contig00034997
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034997 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE28418.1 hypothetical protein AXG93_115s1070 [Marchantia polym... 55 6e-06 >OAE28418.1 hypothetical protein AXG93_115s1070 [Marchantia polymorpha subsp. polymorpha] Length = 1081 Score = 54.7 bits (130), Expect = 6e-06 Identities = 27/63 (42%), Positives = 41/63 (65%) Frame = +1 Query: 88 DERLASMIFGQQYQEKQSFNELLNAFSLSNAEAEFRRALKELIQEHLNTCVTNESNNRIT 267 D R+A+++ QQ Q KQ +LL A ++NA+ EFR L+EL+++HLNTC+ S + Sbjct: 271 DARIAAIMHLQQLQHKQEVMQLLEAHPVTNADTEFRMQLEELVRDHLNTCMALASCSTSH 330 Query: 268 TNS 276 NS Sbjct: 331 DNS 333