BLASTX nr result
ID: Angelica27_contig00034942
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034942 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ADE76969.1 unknown [Picea sitchensis] 113 4e-28 AGM34021.1 class III homeodomain leucine zipper protein 31 [Lari... 113 4e-27 ABB93495.1 homeodomain-leucine zipper trancription factor HB-3 [... 113 4e-27 ABB94099.1 homeodomain-leucine zipper trancription factor HB-3 [... 113 4e-27 ABB94031.1 homeodomain-leucine zipper trancription factor HB-3 [... 113 4e-27 ABB93496.1 homeodomain-leucine zipper trancription factor HB-3 [... 113 4e-27 ABD90527.1 class III homeodomain-leucine zipper [Pseudotsuga men... 113 4e-27 ABD75309.1 class III homeodomain-leucine zipper protein C3HDZ1 [... 113 4e-27 ADV04322.1 class III homeodomain leucine zipper protein [Picea g... 112 7e-27 ABB93543.1 homeodomain-leucine zipper trancription factor HB-3 [... 112 1e-26 ACA33848.1 class III HD-Zip transcription factor HDZ31, partial ... 110 3e-26 ABG73245.1 class III HD-Zip protein HDZ31 [Pinus taeda] 110 3e-26 AIV98135.1 class III HD-Zip protein HDZ2 [Cunninghamia lanceolata] 108 2e-25 ACA33840.1 class III HD-Zip transcription factor HDZ31, partial ... 108 3e-25 ABD75311.1 class III homeodomain-leucine zipper protein C3HDZ1 [... 107 6e-25 AJP06304.1 HB4 [Pinus tabuliformis] 107 6e-25 AFG46558.1 hypothetical protein CL4011Contig1_03, partial [Pinus... 97 1e-24 ABD90526.1 class III homeodomain-leucine zipper [Ginkgo biloba] 106 1e-24 ABD75306.1 class III homeodomain-leucine zipper protein C3HDZ1 [... 106 1e-24 AEW09111.1 hypothetical protein CL4011Contig1_03, partial [Pinus... 96 3e-24 >ADE76969.1 unknown [Picea sitchensis] Length = 353 Score = 113 bits (283), Expect = 4e-28 Identities = 62/89 (69%), Positives = 67/89 (75%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD A++NLRSVLTIAFQFTYE+HLRE Sbjct: 135 LESRTDGSG--GPNRTLDLASALEVGSAGTRTSGDSGANSNLRSVLTIAFQFTYESHLRE 192 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 193 NVAAMARQYVRSVVASVQRVAMALAPSRL 221 >AGM34021.1 class III homeodomain leucine zipper protein 31 [Larix kaempferi] Length = 842 Score = 113 bits (283), Expect = 4e-27 Identities = 62/89 (69%), Positives = 67/89 (75%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD A++NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSAGTRTSGDSGANSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 654 NVAAMARQYVRTVVASVQRVAMALAPSRL 682 >ABB93495.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93497.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93498.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93499.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93500.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93501.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93502.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93503.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93504.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93505.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93506.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93507.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93508.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93509.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93510.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93511.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93512.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93513.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93514.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93515.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93516.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93517.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93518.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93519.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93520.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93521.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93522.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93523.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93524.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93525.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93526.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93527.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93528.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93529.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93530.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93531.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93532.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93533.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93534.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93535.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93536.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93537.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93538.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93539.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93540.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] ABB93541.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93542.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93544.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93545.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93546.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93547.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93548.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93550.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93551.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93552.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93554.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93555.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93556.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93557.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93559.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93560.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93561.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93562.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93563.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93564.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93565.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93567.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93568.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93569.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93570.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93571.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93572.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93573.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93574.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93575.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93576.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93578.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93579.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93580.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93581.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93583.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93584.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93585.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93586.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93587.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93588.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93589.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93590.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93592.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB94009.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94010.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94011.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94012.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94013.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94014.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94015.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94016.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94017.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94018.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94019.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94020.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94021.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94022.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94023.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94024.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94025.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94026.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94027.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94028.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94029.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94030.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94032.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94033.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94034.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94035.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94036.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94037.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94038.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94039.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94040.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94041.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94042.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94043.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94044.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94045.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94046.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94047.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94048.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94049.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94050.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94051.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94052.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94053.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94054.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94055.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94056.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94057.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94058.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94059.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94060.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94061.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94062.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94063.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94064.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94065.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94066.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94067.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94068.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94069.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94070.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94071.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94072.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94073.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94074.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94075.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94076.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94077.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94078.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94079.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94080.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94081.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94082.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94083.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94084.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94085.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94086.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94087.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94088.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94089.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94090.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94091.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94092.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94093.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94094.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94095.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94096.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94097.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94098.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94100.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94101.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94102.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94103.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94104.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94105.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94106.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94107.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94108.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94109.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94110.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94111.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94112.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94113.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94114.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94115.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94116.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94117.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94118.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94119.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94120.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94121.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94122.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94123.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94124.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94125.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94126.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94127.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] ABB94128.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 113 bits (283), Expect = 4e-27 Identities = 62/89 (69%), Positives = 67/89 (75%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD A++NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSAGTRTSGDSGANSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 654 NVAAMARQYVRSVVASVQRVAMALAPSRL 682 >ABB94099.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 113 bits (283), Expect = 4e-27 Identities = 62/89 (69%), Positives = 67/89 (75%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD A++NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSAGTRTSGDSGANSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 654 NVAAMARQYVRSVVASVQRVAMALAPSRL 682 >ABB94031.1 homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 113 bits (283), Expect = 4e-27 Identities = 62/89 (69%), Positives = 67/89 (75%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD A++NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSAGTRTSGDSGANSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 654 NVAAMARQYVRSVVASVQRVAMALAPSRL 682 >ABB93496.1 homeodomain-leucine zipper trancription factor HB-3 [Picea abies] Length = 842 Score = 113 bits (283), Expect = 4e-27 Identities = 62/89 (69%), Positives = 67/89 (75%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD A++NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSAGTRTSGDSGANSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 654 NVAAMARQYVRSVVASVQRVAMALAPSRL 682 >ABD90527.1 class III homeodomain-leucine zipper [Pseudotsuga menziesii] Length = 842 Score = 113 bits (283), Expect = 4e-27 Identities = 62/89 (69%), Positives = 67/89 (75%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD A++NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSAGTRTSGDSGANSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 654 NVAAMARQYVRTVVASVQRVAMALAPSRL 682 >ABD75309.1 class III homeodomain-leucine zipper protein C3HDZ1 [Pseudotsuga menziesii] Length = 842 Score = 113 bits (283), Expect = 4e-27 Identities = 62/89 (69%), Positives = 67/89 (75%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD A++NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSAGTRTSGDSGANSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 654 NVAAMARQYVRTVVASVQRVAMALAPSRL 682 >ADV04322.1 class III homeodomain leucine zipper protein [Picea glauca] Length = 842 Score = 112 bits (281), Expect = 7e-27 Identities = 62/89 (69%), Positives = 67/89 (75%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD A++NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSAGARTSGDSGANSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 654 NVAAMARQYVRSVVASVQRVAMALAPSRL 682 >ABB93543.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93549.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93553.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93558.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93566.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93577.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93582.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] ABB93591.1 homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] Length = 842 Score = 112 bits (279), Expect = 1e-26 Identities = 61/89 (68%), Positives = 66/89 (74%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGSAG R GD ++NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSAGTRTSGDSGTNSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 654 NVAAMARQYVRSVVASVQRVAMALAPSRL 682 >ACA33848.1 class III HD-Zip transcription factor HDZ31, partial [Pinus taeda] Length = 590 Score = 110 bits (276), Expect = 3e-26 Identities = 60/89 (67%), Positives = 65/89 (73%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGS G R GD S+NLRSVLTIAFQFTYE+HLRE Sbjct: 406 LESRTDGSG--GPNRTLDLASALEVGSTGTRTSGDSGTSSNLRSVLTIAFQFTYESHLRE 463 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY ++PSRL Sbjct: 464 NVAAMARQYVRSVVASVQRVAMAIAPSRL 492 >ABG73245.1 class III HD-Zip protein HDZ31 [Pinus taeda] Length = 842 Score = 110 bits (276), Expect = 3e-26 Identities = 60/89 (67%), Positives = 65/89 (73%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGS G R GD S+NLRSVLTIAFQFTYE+HLRE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSTGTRTSGDSGTSSNLRSVLTIAFQFTYESHLRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY ++PSRL Sbjct: 654 NVAAMARQYVRSVVASVQRVAMAIAPSRL 682 >AIV98135.1 class III HD-Zip protein HDZ2 [Cunninghamia lanceolata] Length = 840 Score = 108 bits (270), Expect = 2e-25 Identities = 60/89 (67%), Positives = 64/89 (71%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTD + G NRTLDLASALEVGS G R GD A++NLRSVLTIAFQFTYENHLRE Sbjct: 594 LESRTDVSA--GANRTLDLASALEVGSTGTRASGDSGANSNLRSVLTIAFQFTYENHLRE 651 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 652 NVAAMARQYVRSVVASVQRVAMALAPSRL 680 >ACA33840.1 class III HD-Zip transcription factor HDZ31, partial [Pinus pinaster] Length = 628 Score = 108 bits (269), Expect = 3e-25 Identities = 59/89 (66%), Positives = 64/89 (71%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGS G R GD ++NLRSVLTIAFQFTYE+H RE Sbjct: 441 LESRTDGSG--GPNRTLDLASALEVGSTGTRTSGDSGTNSNLRSVLTIAFQFTYESHSRE 498 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 499 NVAAMARQYVRSVVASVQRVAMALAPSRL 527 >ABD75311.1 class III homeodomain-leucine zipper protein C3HDZ1 [Taxus globosa] Length = 837 Score = 107 bits (267), Expect = 6e-25 Identities = 60/89 (67%), Positives = 64/89 (71%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRT AG NRTLDLASALEVGS G+R GD A++NLRSVLTIAFQFTYENHLRE Sbjct: 592 LESRTVSAG---ANRTLDLASALEVGSTGSRASGDSGANSNLRSVLTIAFQFTYENHLRE 648 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 NVAAMARQY L+PSRL Sbjct: 649 NVAAMARQYVRSVVASVQRVAMALAPSRL 677 >AJP06304.1 HB4 [Pinus tabuliformis] Length = 842 Score = 107 bits (267), Expect = 6e-25 Identities = 58/89 (65%), Positives = 64/89 (71%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGS G R GD ++NLRSVLTIAFQFTYE+H+RE Sbjct: 596 LESRTDGSG--GPNRTLDLASALEVGSTGTRTSGDSGTNSNLRSVLTIAFQFTYESHMRE 653 Query: 181 NVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 VAAMARQY L+PSRL Sbjct: 654 TVAAMARQYVRSVVASVQRVAMALAPSRL 682 >AFG46558.1 hypothetical protein CL4011Contig1_03, partial [Pinus taeda] AFG46559.1 hypothetical protein CL4011Contig1_03, partial [Pinus taeda] AFG46560.1 hypothetical protein CL4011Contig1_03, partial [Pinus taeda] AFG46561.1 hypothetical protein CL4011Contig1_03, partial [Pinus taeda] AFG46562.1 hypothetical protein CL4011Contig1_03, partial [Pinus taeda] AFG46563.1 hypothetical protein CL4011Contig1_03, partial [Pinus taeda] AFG46564.1 hypothetical protein CL4011Contig1_03, partial [Pinus taeda] Length = 68 Score = 97.4 bits (241), Expect = 1e-24 Identities = 51/64 (79%), Positives = 54/64 (84%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGS G R GD S+NLRSVLTIAFQFTYE+HLRE Sbjct: 7 LESRTDGSG--GPNRTLDLASALEVGSTGTRTSGDSGTSSNLRSVLTIAFQFTYESHLRE 64 Query: 181 NVAA 192 NVAA Sbjct: 65 NVAA 68 >ABD90526.1 class III homeodomain-leucine zipper [Ginkgo biloba] Length = 842 Score = 106 bits (264), Expect = 1e-24 Identities = 61/90 (67%), Positives = 65/90 (72%), Gaps = 1/90 (1%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGD-GSASANLRSVLTIAFQFTYENHLR 177 L+SRTDG G NRTLDLASALEVGSAG R GD G+ S NLRSVLTIAFQFTYENHLR Sbjct: 595 LDSRTDGTS--GPNRTLDLASALEVGSAGTRTSGDSGANSFNLRSVLTIAFQFTYENHLR 652 Query: 178 ENVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 ENVA+MARQY L+PSRL Sbjct: 653 ENVASMARQYVRSVVASVQRVAMALAPSRL 682 >ABD75306.1 class III homeodomain-leucine zipper protein C3HDZ1 [Ginkgo biloba] Length = 842 Score = 106 bits (264), Expect = 1e-24 Identities = 61/90 (67%), Positives = 65/90 (72%), Gaps = 1/90 (1%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGD-GSASANLRSVLTIAFQFTYENHLR 177 L+SRTDG G NRTLDLASALEVGSAG R GD G+ S NLRSVLTIAFQFTYENHLR Sbjct: 595 LDSRTDGTS--GPNRTLDLASALEVGSAGTRTSGDSGANSFNLRSVLTIAFQFTYENHLR 652 Query: 178 ENVAAMARQYXXXXXXXXXXXXXXLSPSRL 267 ENVA+MARQY L+PSRL Sbjct: 653 ENVASMARQYVRSVVASVQRVAMALAPSRL 682 >AEW09111.1 hypothetical protein CL4011Contig1_03, partial [Pinus radiata] Length = 68 Score = 96.3 bits (238), Expect = 3e-24 Identities = 50/64 (78%), Positives = 54/64 (84%) Frame = +1 Query: 1 LESRTDGAGNVGTNRTLDLASALEVGSAGNRVPGDGSASANLRSVLTIAFQFTYENHLRE 180 LESRTDG+G G NRTLDLASALEVGS G R GD ++NLRSVLTIAFQFTYE+HLRE Sbjct: 7 LESRTDGSG--GPNRTLDLASALEVGSTGTRTSGDSGTNSNLRSVLTIAFQFTYESHLRE 64 Query: 181 NVAA 192 NVAA Sbjct: 65 NVAA 68