BLASTX nr result
ID: Angelica27_contig00034901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034901 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244677.1 PREDICTED: vesicle-fusing ATPase-like isoform X3 ... 68 2e-11 XP_017244675.1 PREDICTED: vesicle-fusing ATPase-like isoform X1 ... 68 2e-11 KZM99535.1 hypothetical protein DCAR_013103 [Daucus carota subsp... 68 2e-11 KVG50966.1 hypothetical protein Ccrd_026381 [Cynara cardunculus ... 54 1e-07 KVI10498.1 AAA+ ATPase domain-containing protein [Cynara cardunc... 57 1e-07 XP_011098317.1 PREDICTED: vesicle-fusing ATPase [Sesamum indicum] 57 1e-07 KVI03038.1 AAA+ ATPase domain-containing protein [Cynara cardunc... 57 2e-07 XP_016574871.1 PREDICTED: vesicle-fusing ATPase [Capsicum annuum] 57 3e-07 OAY24816.1 hypothetical protein MANES_17G045800 [Manihot esculenta] 56 4e-07 OIS99043.1 vesicle-fusing atpase [Nicotiana attenuata] 56 4e-07 XP_019251692.1 PREDICTED: vesicle-fusing ATPase [Nicotiana atten... 56 4e-07 BAA13101.1 N-ethylmaleimide sensitive fusion protein [Nicotiana ... 56 4e-07 XP_009759969.1 PREDICTED: vesicle-fusing ATPase [Nicotiana sylve... 56 4e-07 XP_009626763.1 PREDICTED: vesicle-fusing ATPase [Nicotiana tomen... 56 4e-07 OAY24815.1 hypothetical protein MANES_17G045800 [Manihot esculenta] 56 4e-07 AGO67238.1 N-ethylmaleimide sensitive fusion protein [Silene vul... 56 4e-07 OAY26193.1 hypothetical protein MANES_16G027900 [Manihot esculenta] 56 5e-07 XP_015062393.1 PREDICTED: vesicle-fusing ATPase [Solanum pennellii] 55 7e-07 XP_006351809.1 PREDICTED: vesicle-fusing ATPase [Solanum tuberosum] 55 7e-07 XP_004230528.1 PREDICTED: vesicle-fusing ATPase [Solanum lycoper... 55 7e-07 >XP_017244677.1 PREDICTED: vesicle-fusing ATPase-like isoform X3 [Daucus carota subsp. sativus] Length = 633 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/49 (69%), Positives = 35/49 (71%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY*R 212 MPIKKMYMVLEM VYSGKQTISISHFHECLQDA +Y R Sbjct: 585 MPIKKMYMVLEMAAQGEEGGGAEDVYSGKQTISISHFHECLQDAIKYQR 633 >XP_017244675.1 PREDICTED: vesicle-fusing ATPase-like isoform X1 [Daucus carota subsp. sativus] Length = 740 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/49 (69%), Positives = 35/49 (71%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY*R 212 MPIKKMYMVLEM VYSGKQTISISHFHECLQDA +Y R Sbjct: 692 MPIKKMYMVLEMAAQGEEGGGAEDVYSGKQTISISHFHECLQDAIKYQR 740 >KZM99535.1 hypothetical protein DCAR_013103 [Daucus carota subsp. sativus] Length = 857 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/49 (69%), Positives = 35/49 (71%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY*R 212 MPIKKMYMVLEM VYSGKQTISISHFHECLQDA +Y R Sbjct: 705 MPIKKMYMVLEMAAQGEEGGGAEDVYSGKQTISISHFHECLQDAIKYQR 753 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/49 (69%), Positives = 35/49 (71%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY*R 212 MPIKKMYMVLEM VYSGKQTISISHFHECLQDA +Y R Sbjct: 809 MPIKKMYMVLEMAAQGEEGGGAEDVYSGKQTISISHFHECLQDAIKYQR 857 >KVG50966.1 hypothetical protein Ccrd_026381 [Cynara cardunculus var. scolymus] Length = 76 Score = 53.9 bits (128), Expect = 1e-07 Identities = 24/47 (51%), Positives = 31/47 (65%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIK++YMV+EM +YS K+TI ISHF+ECL+D RY Sbjct: 30 MPIKRLYMVVEMAAQGDSSGSTEAIYSDKETIQISHFYECLKDIIRY 76 >KVI10498.1 AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 643 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIK++YMV+EM +YSGK+TI ISHF++CLQD RY Sbjct: 597 MPIKRLYMVVEMAAQGEYGGGAEAIYSGKETIQISHFYDCLQDIVRY 643 >XP_011098317.1 PREDICTED: vesicle-fusing ATPase [Sesamum indicum] Length = 732 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MP+KK+YMV+EM +YSGKQ I+ISHF++CLQD RY Sbjct: 686 MPLKKLYMVVEMAAQGEHGGAAEAIYSGKQKINISHFYDCLQDVVRY 732 >KVI03038.1 AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 730 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIK++YMV+EM +YSGK+TI ISHF+ECL+D RY Sbjct: 684 MPIKRLYMVVEMAAQGESGGSAEAIYSGKETIQISHFYECLKDIVRY 730 >XP_016574871.1 PREDICTED: vesicle-fusing ATPase [Capsicum annuum] Length = 741 Score = 56.6 bits (135), Expect = 3e-07 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YMV+EM +YSGK+ I+ISHF++CLQD RY Sbjct: 695 MPIKKLYMVVEMAAQGEHGGTAEAIYSGKEKINISHFYDCLQDIVRY 741 >OAY24816.1 hypothetical protein MANES_17G045800 [Manihot esculenta] Length = 557 Score = 56.2 bits (134), Expect = 4e-07 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YM++EM +YSGKQ I+I+HF++CLQD RY Sbjct: 511 MPIKKLYMLIEMAAQGEQGGAAEAIYSGKQKINIAHFYDCLQDVVRY 557 >OIS99043.1 vesicle-fusing atpase [Nicotiana attenuata] Length = 603 Score = 56.2 bits (134), Expect = 4e-07 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YMV+EM +YSGK+ I ISHF++CLQD RY Sbjct: 557 MPIKKLYMVVEMAAQGEHGGTAEAIYSGKEKIQISHFYDCLQDIARY 603 >XP_019251692.1 PREDICTED: vesicle-fusing ATPase [Nicotiana attenuata] Length = 739 Score = 56.2 bits (134), Expect = 4e-07 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YMV+EM +YSGK+ I ISHF++CLQD RY Sbjct: 693 MPIKKLYMVVEMAAQGEHGGTAEAIYSGKEKIQISHFYDCLQDIARY 739 >BAA13101.1 N-ethylmaleimide sensitive fusion protein [Nicotiana tabacum] Length = 739 Score = 56.2 bits (134), Expect = 4e-07 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YMV+EM +YSGK+ I ISHF++CLQD RY Sbjct: 693 MPIKKLYMVVEMAAQGEHGGTGEAIYSGKEKIQISHFYDCLQDIARY 739 >XP_009759969.1 PREDICTED: vesicle-fusing ATPase [Nicotiana sylvestris] XP_009759970.1 PREDICTED: vesicle-fusing ATPase [Nicotiana sylvestris] XP_016476154.1 PREDICTED: vesicle-fusing ATPase-like [Nicotiana tabacum] XP_016476155.1 PREDICTED: vesicle-fusing ATPase-like [Nicotiana tabacum] Length = 739 Score = 56.2 bits (134), Expect = 4e-07 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YMV+EM +YSGK+ I ISHF++CLQD RY Sbjct: 693 MPIKKLYMVVEMAAQGEHGGTAEAIYSGKEKIQISHFYDCLQDIARY 739 >XP_009626763.1 PREDICTED: vesicle-fusing ATPase [Nicotiana tomentosiformis] XP_016498766.1 PREDICTED: vesicle-fusing ATPase-like [Nicotiana tabacum] Length = 739 Score = 56.2 bits (134), Expect = 4e-07 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YMV+EM +YSGK+ I ISHF++CLQD RY Sbjct: 693 MPIKKLYMVVEMAAQGEHGGTAEAIYSGKEKIQISHFYDCLQDIARY 739 >OAY24815.1 hypothetical protein MANES_17G045800 [Manihot esculenta] Length = 740 Score = 56.2 bits (134), Expect = 4e-07 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YM++EM +YSGKQ I+I+HF++CLQD RY Sbjct: 694 MPIKKLYMLIEMAAQGEQGGAAEAIYSGKQKINIAHFYDCLQDVVRY 740 >AGO67238.1 N-ethylmaleimide sensitive fusion protein [Silene vulgaris] Length = 842 Score = 56.2 bits (134), Expect = 4e-07 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YM++EM +YSGK+ I ISHF+ECLQD RY Sbjct: 796 MPIKKLYMLVEMAAQGEQGGKAEAIYSGKEKIDISHFYECLQDIVRY 842 >OAY26193.1 hypothetical protein MANES_16G027900 [Manihot esculenta] Length = 740 Score = 55.8 bits (133), Expect = 5e-07 Identities = 24/47 (51%), Positives = 31/47 (65%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YM++EM +YSGKQ I I+HF++CLQD RY Sbjct: 694 MPIKKLYMLIEMAAQGEQGGAAEAIYSGKQKIKIAHFYDCLQDVVRY 740 >XP_015062393.1 PREDICTED: vesicle-fusing ATPase [Solanum pennellii] Length = 743 Score = 55.5 bits (132), Expect = 7e-07 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YMV+EM +YSGK+ I+I+HF++CLQD RY Sbjct: 697 MPIKKLYMVVEMAAQGEHGGTAEAIYSGKEKINIAHFYDCLQDIVRY 743 >XP_006351809.1 PREDICTED: vesicle-fusing ATPase [Solanum tuberosum] Length = 743 Score = 55.5 bits (132), Expect = 7e-07 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YMV+EM +YSGK+ I+I+HF++CLQD RY Sbjct: 697 MPIKKLYMVVEMAAQGEHGGTAEAIYSGKEKINIAHFYDCLQDIVRY 743 >XP_004230528.1 PREDICTED: vesicle-fusing ATPase [Solanum lycopersicum] Length = 743 Score = 55.5 bits (132), Expect = 7e-07 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 66 MPIKKMYMVLEMXXXXXXXXXXXXVYSGKQTISISHFHECLQDATRY 206 MPIKK+YMV+EM +YSGK+ I+I+HF++CLQD RY Sbjct: 697 MPIKKLYMVVEMAAQGEHGGTAEAIYSGKEKINIAHFYDCLQDIVRY 743