BLASTX nr result
ID: Angelica27_contig00034893
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034893 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM81094.1 hypothetical protein DCAR_031318 [Daucus carota subsp... 56 3e-07 >KZM81094.1 hypothetical protein DCAR_031318 [Daucus carota subsp. sativus] Length = 329 Score = 55.8 bits (133), Expect = 3e-07 Identities = 30/63 (47%), Positives = 41/63 (65%) Frame = -2 Query: 236 GVIKERNDESKLVNNEVDGKDGQKMETTDGDSLYAFKLALTDFVKELLTPTYIRGQIDRV 57 G IKE +E + N++V G G++ E T G + YAFK AL D VKELL+PTY + ID+ Sbjct: 217 GKIKEGENEGES-NDKVKGNTGEQKEPTYGKNHYAFKCALVDLVKELLSPTYSKNLIDKE 275 Query: 56 VYK 48 +K Sbjct: 276 SFK 278