BLASTX nr result
ID: Angelica27_contig00034761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034761 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017251414.1 PREDICTED: myb-related protein B-like [Daucus car... 65 2e-10 KZM96230.1 hypothetical protein DCAR_019472 [Daucus carota subsp... 65 2e-10 >XP_017251414.1 PREDICTED: myb-related protein B-like [Daucus carota subsp. sativus] Length = 235 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 PEVFWDVMRNVIAREVRDYVTTSFQDGPGYR 95 PEVFWDVMRNVIAREVRDYVTTSFQ+G GYR Sbjct: 205 PEVFWDVMRNVIAREVRDYVTTSFQEGSGYR 235 >KZM96230.1 hypothetical protein DCAR_019472 [Daucus carota subsp. sativus] Length = 236 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 PEVFWDVMRNVIAREVRDYVTTSFQDGPGYR 95 PEVFWDVMRNVIAREVRDYVTTSFQ+G GYR Sbjct: 206 PEVFWDVMRNVIAREVRDYVTTSFQEGSGYR 236