BLASTX nr result
ID: Angelica27_contig00034572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034572 (266 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017253301.1 PREDICTED: KH domain-containing protein At4g18375... 112 4e-27 >XP_017253301.1 PREDICTED: KH domain-containing protein At4g18375-like [Daucus carota subsp. sativus] KZM93952.1 hypothetical protein DCAR_017197 [Daucus carota subsp. sativus] Length = 731 Score = 112 bits (281), Expect = 4e-27 Identities = 54/72 (75%), Positives = 57/72 (79%), Gaps = 1/72 (1%) Frame = -2 Query: 265 YSDFGAHDQYKNPQHGSHHDLNSQP-TYPLNNALQTPYHNVTQQQATYQNYQSVSTPQAP 89 Y DF A DQYK P H SHHDLNSQP YP N+A PY+NVTQQQA+YQNYQS ST Q P Sbjct: 660 YPDFAAQDQYKKPVHVSHHDLNSQPPAYPNNSAPHNPYNNVTQQQASYQNYQSGSTLQPP 719 Query: 88 YHNISAPNSYQY 53 YHNISAPNSYQY Sbjct: 720 YHNISAPNSYQY 731