BLASTX nr result
ID: Angelica27_contig00034554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034554 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017250485.1 PREDICTED: alkane hydroxylase MAH1-like [Daucus c... 61 8e-09 XP_017249899.1 PREDICTED: alkane hydroxylase MAH1-like [Daucus c... 60 1e-08 XP_017251561.1 PREDICTED: alkane hydroxylase MAH1-like [Daucus c... 60 2e-08 XP_017250649.1 PREDICTED: alkane hydroxylase MAH1-like [Daucus c... 60 2e-08 XP_017250246.1 PREDICTED: alkane hydroxylase MAH1-like isoform X... 58 7e-08 >XP_017250485.1 PREDICTED: alkane hydroxylase MAH1-like [Daucus carota subsp. sativus] Length = 505 Score = 60.8 bits (146), Expect = 8e-09 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -1 Query: 280 AISIIHNYKIKLVKDHQVIPSDSIILQMKYGLKAMV 173 AIS+IHNY++K+V HQV+PSDSI+LQMKYGLKA + Sbjct: 465 AISMIHNYRVKVVDGHQVVPSDSIVLQMKYGLKARI 500 >XP_017249899.1 PREDICTED: alkane hydroxylase MAH1-like [Daucus carota subsp. sativus] Length = 503 Score = 60.5 bits (145), Expect = 1e-08 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -1 Query: 280 AISIIHNYKIKLVKDHQVIPSDSIILQMKYGLKAMV 173 AIS+IHNY++++V+ HQV+PSDSIILQMKYGLKA + Sbjct: 463 AISMIHNYRVEVVEGHQVVPSDSIILQMKYGLKARI 498 >XP_017251561.1 PREDICTED: alkane hydroxylase MAH1-like [Daucus carota subsp. sativus] Length = 503 Score = 60.1 bits (144), Expect = 2e-08 Identities = 25/36 (69%), Positives = 34/36 (94%) Frame = -1 Query: 280 AISIIHNYKIKLVKDHQVIPSDSIILQMKYGLKAMV 173 AIS+IHNY++++V+ HQV+PSDSI+LQMKYGLKA + Sbjct: 463 AISMIHNYRVEVVEGHQVVPSDSIVLQMKYGLKAKI 498 >XP_017250649.1 PREDICTED: alkane hydroxylase MAH1-like [Daucus carota subsp. sativus] Length = 511 Score = 59.7 bits (143), Expect = 2e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 280 AISIIHNYKIKLVKDHQVIPSDSIILQMKYGLKAMV 173 A SI+HNYKI++VK QV+PSDS+ILQMKYGLK MV Sbjct: 471 ATSILHNYKIEVVKGQQVVPSDSVILQMKYGLKVMV 506 >XP_017250246.1 PREDICTED: alkane hydroxylase MAH1-like isoform X1 [Daucus carota subsp. sativus] Length = 515 Score = 58.2 bits (139), Expect = 7e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 280 AISIIHNYKIKLVKDHQVIPSDSIILQMKYGLKAMV 173 AISII NY+I +V+ HQV+PSDSIILQMKYGLKA + Sbjct: 471 AISIIRNYRIDVVEGHQVVPSDSIILQMKYGLKAKI 506