BLASTX nr result
ID: Angelica27_contig00034520
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034520 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017216990.1 PREDICTED: glycine-rich cell wall structural prot... 65 1e-09 >XP_017216990.1 PREDICTED: glycine-rich cell wall structural protein-like [Daucus carota subsp. sativus] KZM86711.1 hypothetical protein DCAR_023845 [Daucus carota subsp. sativus] Length = 316 Score = 64.7 bits (156), Expect = 1e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 297 ECRKLEDDNGAAAGKVKKPEWFFDGQPWFTNN 202 ECRKLE DNG + GKVKKPEWFFDGQPWFTNN Sbjct: 22 ECRKLEADNGGS-GKVKKPEWFFDGQPWFTNN 52