BLASTX nr result
ID: Angelica27_contig00034420
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034420 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017256142.1 PREDICTED: pentatricopeptide repeat-containing pr... 104 3e-24 XP_018841966.1 PREDICTED: pentatricopeptide repeat-containing pr... 93 5e-20 XP_006423060.1 hypothetical protein CICLE_v10028118mg [Citrus cl... 91 2e-19 KDO49128.1 hypothetical protein CISIN_1g004231mg [Citrus sinensi... 91 2e-19 XP_010107974.1 hypothetical protein L484_027566 [Morus notabilis... 91 2e-19 XP_006480134.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 3e-19 XP_017633842.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 4e-19 XP_016714587.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 4e-19 XP_015874279.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 6e-19 XP_007042371.2 PREDICTED: pentatricopeptide repeat-containing pr... 89 1e-18 EOX98202.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 89 1e-18 KCW55237.1 hypothetical protein EUGRSUZ_I01171 [Eucalyptus grandis] 89 1e-18 XP_010028496.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 1e-18 XP_016733726.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 2e-18 XP_012480280.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 2e-18 XP_019169498.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 4e-18 OMO74126.1 hypothetical protein CCACVL1_16937 [Corchorus capsula... 85 4e-18 KVH93259.1 Pentatricopeptide repeat-containing protein [Cynara c... 86 9e-18 XP_008243127.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 2e-17 ONH94916.1 hypothetical protein PRUPE_7G039700 [Prunus persica] 85 3e-17 >XP_017256142.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Daucus carota subsp. sativus] KZM90576.1 hypothetical protein DCAR_022059 [Daucus carota subsp. sativus] Length = 746 Score = 104 bits (260), Expect = 3e-24 Identities = 52/60 (86%), Positives = 57/60 (95%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGRSEHA 182 DEL+QVIENTLRSCQLTDAELAK+LVQIN+KEGNTDAAFDVL EMA+DGLLPNSG+S A Sbjct: 687 DELNQVIENTLRSCQLTDAELAKVLVQINNKEGNTDAAFDVLNEMARDGLLPNSGKSTRA 746 >XP_018841966.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Juglans regia] XP_018841967.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Juglans regia] Length = 752 Score = 92.8 bits (229), Expect = 5e-20 Identities = 45/60 (75%), Positives = 53/60 (88%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGRSEHA 182 +ELS+VI N LRSC+LTDAELAK+LV+IN KEGN DA F+VL EMAKDGLLPNSGR+ +A Sbjct: 691 EELSEVIGNVLRSCRLTDAELAKVLVEINQKEGNMDAVFNVLTEMAKDGLLPNSGRTSYA 750 >XP_006423060.1 hypothetical protein CICLE_v10028118mg [Citrus clementina] ESR36300.1 hypothetical protein CICLE_v10028118mg [Citrus clementina] Length = 557 Score = 91.3 bits (225), Expect = 2e-19 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGRSEH 179 +ELSQVIEN LRSC+L+DAELAK+LV+IN KEGN DA +VL EMAKDGLLPNSGRS + Sbjct: 497 EELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTY 555 >KDO49128.1 hypothetical protein CISIN_1g004231mg [Citrus sinensis] KDO49129.1 hypothetical protein CISIN_1g004231mg [Citrus sinensis] Length = 766 Score = 91.3 bits (225), Expect = 2e-19 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGRSEH 179 +ELSQVIEN LRSC+L+DAELAK+LV+IN KEGN DA +VL EMAKDGLLPNSGRS + Sbjct: 706 EELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTY 764 >XP_010107974.1 hypothetical protein L484_027566 [Morus notabilis] EXC17374.1 hypothetical protein L484_027566 [Morus notabilis] Length = 749 Score = 90.9 bits (224), Expect = 2e-19 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGRSEH 179 DELS VI NTLRSC+LTDAELAK+LV+IN KEGN DA F VL EMAKDGLLPNSG + + Sbjct: 688 DELSHVIRNTLRSCRLTDAELAKVLVEINHKEGNMDAVFSVLSEMAKDGLLPNSGMTAY 746 >XP_006480134.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Citrus sinensis] XP_015386406.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Citrus sinensis] Length = 766 Score = 90.5 bits (223), Expect = 3e-19 Identities = 45/59 (76%), Positives = 51/59 (86%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGRSEH 179 +ELSQVIEN LRSC+LTDAELAK+LV+IN KEGN DA +VL EMAKDGLLPNSG S + Sbjct: 706 EELSQVIENILRSCRLTDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGSSTY 764 >XP_017633842.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Gossypium arboreum] Length = 745 Score = 90.1 bits (222), Expect = 4e-19 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 DELSQVI N LRSC+LTDAELAK+LV+IN KEGN DAAF+VL EMAKDGLLP SG Sbjct: 691 DELSQVITNILRSCKLTDAELAKILVEINHKEGNMDAAFNVLTEMAKDGLLPKSG 745 >XP_016714587.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Gossypium hirsutum] Length = 745 Score = 90.1 bits (222), Expect = 4e-19 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 DELSQVI N LRSC+LTDAELAK+LV+IN KEGN DAAF+VL EMAKDGLLP SG Sbjct: 691 DELSQVITNILRSCKLTDAELAKILVEINHKEGNMDAAFNVLTEMAKDGLLPKSG 745 >XP_015874279.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Ziziphus jujuba] Length = 751 Score = 89.7 bits (221), Expect = 6e-19 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGR 170 +ELS VI NTLRSCQLTDAELAK+LV+IN KEGN DA F+VL +MAKDGLLPNSG+ Sbjct: 690 EELSTVIGNTLRSCQLTDAELAKVLVEINHKEGNMDAVFNVLAQMAKDGLLPNSGK 745 >XP_007042371.2 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Theobroma cacao] Length = 745 Score = 89.0 bits (219), Expect = 1e-18 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 D++SQVI NT+RSC+L DAELAK+LV+IN KEGN DAAF+VL EMAKDGLLPNSG Sbjct: 691 DKISQVIANTIRSCKLIDAELAKVLVEINHKEGNMDAAFNVLTEMAKDGLLPNSG 745 >EOX98202.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 745 Score = 89.0 bits (219), Expect = 1e-18 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 D++SQVI NT+RSC+L DAELAK+LV+IN KEGN DAAF+VL EMAKDGLLPNSG Sbjct: 691 DKISQVIANTIRSCKLIDAELAKVLVEINHKEGNMDAAFNVLTEMAKDGLLPNSG 745 >KCW55237.1 hypothetical protein EUGRSUZ_I01171 [Eucalyptus grandis] Length = 557 Score = 88.6 bits (218), Expect = 1e-18 Identities = 42/60 (70%), Positives = 52/60 (86%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGRSEHA 182 D+LS+VI NT++SC+L DAE+AK+LV IN KEGN DA F+VL EMAKDGLLPNSGR+ +A Sbjct: 497 DKLSEVIHNTMKSCKLADAEVAKVLVDINHKEGNMDAVFNVLSEMAKDGLLPNSGRTAYA 556 >XP_010028496.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Eucalyptus grandis] XP_010028498.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Eucalyptus grandis] XP_010028500.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Eucalyptus grandis] XP_010028501.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Eucalyptus grandis] XP_018718588.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Eucalyptus grandis] Length = 750 Score = 88.6 bits (218), Expect = 1e-18 Identities = 42/60 (70%), Positives = 52/60 (86%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGRSEHA 182 D+LS+VI NT++SC+L DAE+AK+LV IN KEGN DA F+VL EMAKDGLLPNSGR+ +A Sbjct: 690 DKLSEVIHNTMKSCKLADAEVAKVLVDINHKEGNMDAVFNVLSEMAKDGLLPNSGRTAYA 749 >XP_016733726.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Gossypium hirsutum] XP_016733727.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Gossypium hirsutum] Length = 745 Score = 88.2 bits (217), Expect = 2e-18 Identities = 44/55 (80%), Positives = 48/55 (87%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 DELSQVI N LRSC+LTDAELAK+LV+IN KEGN DA F+VL EMAKDGLLP SG Sbjct: 691 DELSQVITNILRSCKLTDAELAKVLVEINHKEGNMDAVFNVLTEMAKDGLLPKSG 745 >XP_012480280.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Gossypium raimondii] Length = 745 Score = 88.2 bits (217), Expect = 2e-18 Identities = 44/55 (80%), Positives = 48/55 (87%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 DELSQVI N LRSC+LTDAELAK+LV+IN KEGN DA F+VL EMAKDGLLP SG Sbjct: 691 DELSQVITNILRSCKLTDAELAKVLVEINHKEGNMDAVFNVLTEMAKDGLLPKSG 745 >XP_019169498.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Ipomoea nil] Length = 757 Score = 87.4 bits (215), Expect = 4e-18 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = +3 Query: 6 ELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 EL+QV++NTL SC+LTDAE+AK+LV++N KEGN DA F+VLIEMAKDGLLPNSG Sbjct: 704 ELNQVVQNTLSSCRLTDAEVAKVLVEVNCKEGNMDAVFNVLIEMAKDGLLPNSG 757 >OMO74126.1 hypothetical protein CCACVL1_16937 [Corchorus capsularis] Length = 256 Score = 85.1 bits (209), Expect = 4e-18 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 D+LSQVI NTLRS +LTDAELAK+LV+IN KEGN DA +VL EMAKDGLLPNSG Sbjct: 202 DKLSQVIANTLRSSKLTDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSG 256 >KVH93259.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 759 Score = 86.3 bits (212), Expect = 9e-18 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = +3 Query: 6 ELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSGRSEHA 182 E S+VIEN LRSC LTDAELAK LV+IN K+GN DA F +L EMAKDGLLPNSGR+ +A Sbjct: 700 ESSEVIENLLRSCCLTDAELAKALVEINHKQGNMDAVFKILSEMAKDGLLPNSGRTAYA 758 >XP_008243127.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Prunus mume] XP_008243128.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Prunus mume] XP_016652062.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Prunus mume] XP_016652063.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Prunus mume] Length = 751 Score = 85.5 bits (210), Expect = 2e-17 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 +ELSQVI NTLRSCQL+DAELAKLLV IN KEGN + F+VL +MAKDGLLPNSG Sbjct: 690 NELSQVIGNTLRSCQLSDAELAKLLVDINHKEGNMNEVFNVLSDMAKDGLLPNSG 744 >ONH94916.1 hypothetical protein PRUPE_7G039700 [Prunus persica] Length = 751 Score = 84.7 bits (208), Expect = 3e-17 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = +3 Query: 3 DELSQVIENTLRSCQLTDAELAKLLVQINDKEGNTDAAFDVLIEMAKDGLLPNSG 167 +ELSQVI NTLRSCQL+DAELAKL V IN KEGN D F+VL +MAKDGLLPNSG Sbjct: 690 NELSQVIGNTLRSCQLSDAELAKLHVDINHKEGNMDEVFNVLSDMAKDGLLPNSG 744