BLASTX nr result
ID: Angelica27_contig00034184
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034184 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017233639.1 PREDICTED: uncharacterized protein LOC108207719 [... 61 4e-09 XP_017239599.1 PREDICTED: uncharacterized protein LOC108212385 [... 60 7e-09 >XP_017233639.1 PREDICTED: uncharacterized protein LOC108207719 [Daucus carota subsp. sativus] Length = 732 Score = 61.2 bits (147), Expect = 4e-09 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = +2 Query: 68 VEDLNFQRGFDYYFLGFIANDPDYDWSKFGPGCAEDIAEFKVNNAAAIKKKRIELGLE 241 VE +F GF Y GF+ DP+YDWSKF P I EFKV A AI++KR+E+ LE Sbjct: 617 VETSSFASGFRSYVTGFLVVDPEYDWSKFLPATKAWIEEFKVEEAKAIEEKRLEIELE 674 >XP_017239599.1 PREDICTED: uncharacterized protein LOC108212385 [Daucus carota subsp. sativus] Length = 483 Score = 60.5 bits (145), Expect = 7e-09 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 2/64 (3%) Frame = +2 Query: 56 EKQRVED--LNFQRGFDYYFLGFIANDPDYDWSKFGPGCAEDIAEFKVNNAAAIKKKRIE 229 E+Q+ E L + GF Y GF+A DPDYDWS+F P I EFKV A AI+++R+E Sbjct: 346 ERQQAETNRLAYADGFRSYVTGFLAVDPDYDWSRFVPATRTWIEEFKVEQAQAIEERRLE 405 Query: 230 LGLE 241 + LE Sbjct: 406 IELE 409