BLASTX nr result
ID: Angelica27_contig00034168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034168 (233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017238206.1 PREDICTED: squamosa promoter-binding-like protein... 91 6e-20 >XP_017238206.1 PREDICTED: squamosa promoter-binding-like protein 13A [Daucus carota subsp. sativus] XP_017238207.1 PREDICTED: squamosa promoter-binding-like protein 13A [Daucus carota subsp. sativus] XP_017238208.1 PREDICTED: squamosa promoter-binding-like protein 13A [Daucus carota subsp. sativus] KZN02570.1 hypothetical protein DCAR_011324 [Daucus carota subsp. sativus] Length = 381 Score = 90.9 bits (224), Expect = 6e-20 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = +1 Query: 79 SMDIIKTREGLTSLLLPSEMKKTHGISCVKKVLCLVDGCLSDLSKCREYHR 231 SMDIIK R+GL +LLLP EMKKTH +SCVKKV CLVDGC SDLSKCREYHR Sbjct: 57 SMDIIKERDGLKTLLLPLEMKKTHALSCVKKVTCLVDGCSSDLSKCREYHR 107