BLASTX nr result
ID: Angelica27_contig00034165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034165 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219262.1 PREDICTED: ethylene-responsive transcription fact... 88 2e-19 BAF47194.1 embryonic element binding Factor 8, partial [Daucus c... 87 3e-19 >XP_017219262.1 PREDICTED: ethylene-responsive transcription factor ERF017 [Daucus carota subsp. sativus] KZM87670.1 hypothetical protein DCAR_024771 [Daucus carota subsp. sativus] Length = 225 Score = 88.2 bits (217), Expect = 2e-19 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = -2 Query: 304 WESNYSDPDLSYFPSLDDFQDDLFMRPMT-GAIDINEVEEPCDEFGSFLWSF 152 WESNYS PDL YFPS +DFQDDLFMRP+T G +D NEVEE CD+FGSFLWSF Sbjct: 175 WESNYSVPDLGYFPSFEDFQDDLFMRPVTTGPVD-NEVEESCDQFGSFLWSF 225 >BAF47194.1 embryonic element binding Factor 8, partial [Daucus carota] Length = 192 Score = 87.0 bits (214), Expect = 3e-19 Identities = 40/52 (76%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = -2 Query: 304 WESNYSDPDLSYFPSLDDFQDDLFMRPMT-GAIDINEVEEPCDEFGSFLWSF 152 W+SNYS PDL YFPS +DFQDDLFMRP+T G +D NEVEE CD+FGSFLWSF Sbjct: 142 WDSNYSVPDLGYFPSFEDFQDDLFMRPVTTGPVD-NEVEESCDQFGSFLWSF 192