BLASTX nr result
ID: Angelica27_contig00034144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034144 (379 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017229111.1 PREDICTED: RNA cytidine acetyltransferase 1-like ... 56 1e-06 >XP_017229111.1 PREDICTED: RNA cytidine acetyltransferase 1-like [Daucus carota subsp. sativus] KZN08722.1 hypothetical protein DCAR_001378 [Daucus carota subsp. sativus] Length = 1028 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +3 Query: 192 MGKKLDEQVRTLVDDCVKTRHRSFFIIVSDESREQ 296 M KK+DE++RTL+D+ VKTRHRSFF+I+ D+SREQ Sbjct: 1 MRKKVDERIRTLIDNGVKTRHRSFFVIIGDKSREQ 35