BLASTX nr result
ID: Angelica27_contig00034038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00034038 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN07653.1 hypothetical protein DCAR_008490 [Daucus carota subsp... 86 7e-20 KZN04114.1 hypothetical protein DCAR_004951 [Daucus carota subsp... 52 2e-06 >KZN07653.1 hypothetical protein DCAR_008490 [Daucus carota subsp. sativus] Length = 120 Score = 86.3 bits (212), Expect = 7e-20 Identities = 44/68 (64%), Positives = 53/68 (77%) Frame = +2 Query: 5 AYPFVLKLCISLRYDLRPLHSNIAYFSRRFFSRLGRIIFVERQEEDLGSAGRWRRALRLL 184 AYPFVLKLC SLR+ L +++A FS F RLGRIIF R+EE LG+AGRWRRALRL+ Sbjct: 30 AYPFVLKLCNSLRFGLPQSRASVAQFSGLFLFRLGRIIFHGRREEALGNAGRWRRALRLI 89 Query: 185 EEIISSAT 208 +E+IS AT Sbjct: 90 DEMISRAT 97 >KZN04114.1 hypothetical protein DCAR_004951 [Daucus carota subsp. sativus] Length = 115 Score = 52.0 bits (123), Expect = 2e-06 Identities = 30/71 (42%), Positives = 48/71 (67%), Gaps = 3/71 (4%) Frame = +2 Query: 11 PFVLKLCISLRYDLRPLHSNIAYFSRRFFSRLGRIIFVERQEEDLGSAGRWRRALRLLEE 190 PFVLK+ ++LR + ++ ++++ SR F ++ +I+F R+E DLG RW RA+RLL E Sbjct: 33 PFVLKVLLNLR-TIPSVYDDVSHASRLFLFQVNQIVFHIRRE-DLGDRSRWERAIRLLSE 90 Query: 191 IISS---ATPA 214 I+ S +TPA Sbjct: 91 ILVSSRRSTPA 101