BLASTX nr result
ID: Angelica27_contig00031848
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031848 (298 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017248063.1 PREDICTED: gamma-tubulin complex component 3 [Dau... 64 8e-10 XP_010257504.1 PREDICTED: gamma-tubulin complex component 3 [Nel... 56 4e-07 XP_011075100.1 PREDICTED: gamma-tubulin complex component 3 [Ses... 55 1e-06 EYU39957.1 hypothetical protein MIMGU_mgv1a001233mg [Erythranthe... 54 2e-06 XP_012834406.1 PREDICTED: gamma-tubulin complex component 3 [Ery... 54 2e-06 XP_016438533.1 PREDICTED: gamma-tubulin complex component 3-like... 53 7e-06 XP_009605602.1 PREDICTED: gamma-tubulin complex component 3 [Nic... 53 7e-06 >XP_017248063.1 PREDICTED: gamma-tubulin complex component 3 [Daucus carota subsp. sativus] XP_017248064.1 PREDICTED: gamma-tubulin complex component 3 [Daucus carota subsp. sativus] XP_017248065.1 PREDICTED: gamma-tubulin complex component 3 [Daucus carota subsp. sativus] KZM98978.1 hypothetical protein DCAR_013660 [Daucus carota subsp. sativus] Length = 868 Score = 63.9 bits (154), Expect = 8e-10 Identities = 39/67 (58%), Positives = 43/67 (64%), Gaps = 8/67 (11%) Frame = +3 Query: 120 MDQQDSKVLDLVQELVTRLLXXXXXXXXXXXXXX--------QSLKYALRILSSRMTPSI 275 M+Q+D KVLDLV+ELV RLL QSLKYA+RILSSRMTPSI Sbjct: 1 MEQEDQKVLDLVKELVNRLLNSPSTHSSNPINNNCINNNTVQQSLKYAVRILSSRMTPSI 60 Query: 276 AVDEAAM 296 AVDEAAM Sbjct: 61 AVDEAAM 67 >XP_010257504.1 PREDICTED: gamma-tubulin complex component 3 [Nelumbo nucifera] Length = 858 Score = 56.2 bits (134), Expect = 4e-07 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 3/60 (5%) Frame = +3 Query: 126 QQDSKVLDLVQELVTRLLXXXXXXXXXXXXXX---QSLKYALRILSSRMTPSIAVDEAAM 296 ++D K+LDLV+ELV RLL ++LKYA+RIL SRMTPSI+VDEAAM Sbjct: 2 EEDQKILDLVKELVLRLLSPNGADSGPSDHSIDHVKALKYAMRILGSRMTPSISVDEAAM 61 >XP_011075100.1 PREDICTED: gamma-tubulin complex component 3 [Sesamum indicum] Length = 927 Score = 55.1 bits (131), Expect = 1e-06 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 4/63 (6%) Frame = +3 Query: 120 MDQQDSKVLDLVQELVTRLLXXXXXXXXXXXXXXQ----SLKYALRILSSRMTPSIAVDE 287 MD D +V+DLV+ELV RLL Q +LKY+LRILSSRMTPSIA D+ Sbjct: 1 MDDDDHRVVDLVKELVHRLLCTSSQNPNPPSFTQQEYNQALKYSLRILSSRMTPSIAPDD 60 Query: 288 AAM 296 +AM Sbjct: 61 SAM 63 >EYU39957.1 hypothetical protein MIMGU_mgv1a001233mg [Erythranthe guttata] Length = 858 Score = 54.3 bits (129), Expect = 2e-06 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 8/67 (11%) Frame = +3 Query: 120 MDQQDSKVLDLVQELVTRLLXXXXXXXXXXXXXX--------QSLKYALRILSSRMTPSI 275 M+ D +V+DLV+ELV RLL QSLKY+LRILSSRMTPSI Sbjct: 1 MEDDDQRVVDLVKELVHRLLYTSPHPNPQNPSASSFTQQEYNQSLKYSLRILSSRMTPSI 60 Query: 276 AVDEAAM 296 A D++AM Sbjct: 61 AADDSAM 67 >XP_012834406.1 PREDICTED: gamma-tubulin complex component 3 [Erythranthe guttata] Length = 929 Score = 54.3 bits (129), Expect = 2e-06 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 8/67 (11%) Frame = +3 Query: 120 MDQQDSKVLDLVQELVTRLLXXXXXXXXXXXXXX--------QSLKYALRILSSRMTPSI 275 M+ D +V+DLV+ELV RLL QSLKY+LRILSSRMTPSI Sbjct: 1 MEDDDQRVVDLVKELVHRLLYTSPHPNPQNPSASSFTQQEYNQSLKYSLRILSSRMTPSI 60 Query: 276 AVDEAAM 296 A D++AM Sbjct: 61 AADDSAM 67 >XP_016438533.1 PREDICTED: gamma-tubulin complex component 3-like, partial [Nicotiana tabacum] Length = 494 Score = 52.8 bits (125), Expect = 7e-06 Identities = 33/70 (47%), Positives = 39/70 (55%), Gaps = 11/70 (15%) Frame = +3 Query: 120 MDQQDSKVLDLVQELVTRLLXXXXXXXXXXXXXX-----------QSLKYALRILSSRMT 266 MD D + LDLV+ELV RLL Q+L+YA+RILSSRMT Sbjct: 1 MDDGDKRALDLVKELVHRLLSTSPPPPNPNSLNPNPNLPSDQQFHQALRYAIRILSSRMT 60 Query: 267 PSIAVDEAAM 296 PSIA DE+AM Sbjct: 61 PSIAADESAM 70 >XP_009605602.1 PREDICTED: gamma-tubulin complex component 3 [Nicotiana tomentosiformis] Length = 907 Score = 52.8 bits (125), Expect = 7e-06 Identities = 33/70 (47%), Positives = 39/70 (55%), Gaps = 11/70 (15%) Frame = +3 Query: 120 MDQQDSKVLDLVQELVTRLLXXXXXXXXXXXXXX-----------QSLKYALRILSSRMT 266 MD D + LDLV+ELV RLL Q+L+YA+RILSSRMT Sbjct: 1 MDDGDKRALDLVKELVHRLLSTSPPPPTPNSLNPNPNLPSDQQFHQALRYAIRILSSRMT 60 Query: 267 PSIAVDEAAM 296 PSIA DE+AM Sbjct: 61 PSIAADESAM 70