BLASTX nr result
ID: Angelica27_contig00031843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031843 (226 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249351.1 PREDICTED: alpha-L-fucosidase 1 [Daucus carota su... 57 1e-07 >XP_017249351.1 PREDICTED: alpha-L-fucosidase 1 [Daucus carota subsp. sativus] Length = 541 Score = 56.6 bits (135), Expect = 1e-07 Identities = 35/75 (46%), Positives = 36/75 (48%) Frame = -1 Query: 226 LHKIKNSNQDHHPLPIKISTFQLPFSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 47 L KIKNSN DHHPL IKISTFQLP SR Sbjct: 3 LPKIKNSNNDHHPLLIKISTFQLPSSRFTFNFMFLISIFQFTIFSSALPVPPPIPVLPLP 62 Query: 46 XXPQLSWQLTEMALF 2 PQLSWQL+EMALF Sbjct: 63 TSPQLSWQLSEMALF 77