BLASTX nr result
ID: Angelica27_contig00031818
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031818 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237308.1 PREDICTED: dynactin subunit 1-like [Daucus carota... 90 1e-20 XP_017222159.1 PREDICTED: uncharacterized protein LOC108198888 i... 66 5e-11 XP_017222150.1 PREDICTED: uncharacterized protein LOC108198888 i... 66 5e-11 KZN10079.1 hypothetical protein DCAR_002735 [Daucus carota subsp... 53 3e-06 >XP_017237308.1 PREDICTED: dynactin subunit 1-like [Daucus carota subsp. sativus] KZN03718.1 hypothetical protein DCAR_012474 [Daucus carota subsp. sativus] Length = 218 Score = 90.1 bits (222), Expect = 1e-20 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = +2 Query: 86 PCDKTLEEKVDQLVEDVEILKSKINETDFSSDSSSELNYKTLYIRSQKKIQS 241 PC K+LEEKVDQLVEDVEILKSK+NE DF +D SSEL YKTLYIRSQKKIQS Sbjct: 82 PCGKSLEEKVDQLVEDVEILKSKVNERDFPTDGSSELKYKTLYIRSQKKIQS 133 >XP_017222159.1 PREDICTED: uncharacterized protein LOC108198888 isoform X2 [Daucus carota subsp. sativus] Length = 262 Score = 65.9 bits (159), Expect = 5e-11 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = +2 Query: 86 PCDKTLEEKVDQLVEDVEILKSKINETDFSSDSSSELNYKTLYIRSQKKIQS 241 P K+LE++VD+L+ DVE+LK+K+N DFSS SS LNYK LYI SQKK+ + Sbjct: 116 PEGKSLEDRVDELLGDVEVLKNKVNSGDFSSKGSSSLNYKGLYIYSQKKVDA 167 >XP_017222150.1 PREDICTED: uncharacterized protein LOC108198888 isoform X1 [Daucus carota subsp. sativus] Length = 263 Score = 65.9 bits (159), Expect = 5e-11 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = +2 Query: 86 PCDKTLEEKVDQLVEDVEILKSKINETDFSSDSSSELNYKTLYIRSQKKIQS 241 P K+LE++VD+L+ DVE+LK+K+N DFSS SS LNYK LYI SQKK+ + Sbjct: 117 PEGKSLEDRVDELLGDVEVLKNKVNSGDFSSKGSSSLNYKGLYIYSQKKVDA 168 >KZN10079.1 hypothetical protein DCAR_002735 [Daucus carota subsp. sativus] Length = 257 Score = 52.8 bits (125), Expect = 3e-06 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = +2 Query: 86 PCDKTLEEKVDQLVEDVEILKSKINETDFSSDSSSELNYKTLYIRSQKKIQS 241 P K+LE++VD+L+ DVE+ N DFSS SS LNYK LYI SQKK+ + Sbjct: 116 PEGKSLEDRVDELLGDVEV-----NSGDFSSKGSSSLNYKGLYIYSQKKVDA 162