BLASTX nr result
ID: Angelica27_contig00031786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031786 (317 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017233321.1 PREDICTED: two-component response regulator ORR42... 52 2e-06 KZN04489.1 hypothetical protein DCAR_005326 [Daucus carota subsp... 51 9e-06 >XP_017233321.1 PREDICTED: two-component response regulator ORR42-like [Daucus carota subsp. sativus] KZN04811.1 hypothetical protein DCAR_005648 [Daucus carota subsp. sativus] Length = 131 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -1 Query: 317 ETHLVENGKLAEDLIHFGARFDVIFMDFNMLVMNGIEVS 201 ET+ VENG+ A DL+ G +FDVIFMDF+M VMNGI+ + Sbjct: 36 ETYAVENGREAVDLVRSGRQFDVIFMDFSMPVMNGIQAT 74 >KZN04489.1 hypothetical protein DCAR_005326 [Daucus carota subsp. sativus] Length = 133 Score = 50.8 bits (120), Expect = 9e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -1 Query: 317 ETHLVENGKLAEDLIHFGARFDVIFMDFNMLVMNGIEVS 201 ET+ VENG+ A DL+ G +FDVIFMD++M VMNGI+ + Sbjct: 38 ETNAVENGREAVDLVRSGRQFDVIFMDYSMPVMNGIQAT 76