BLASTX nr result
ID: Angelica27_contig00031632
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031632 (352 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN11222.1 hypothetical protein DCAR_003878 [Daucus carota subsp... 111 7e-28 >KZN11222.1 hypothetical protein DCAR_003878 [Daucus carota subsp. sativus] Length = 262 Score = 111 bits (278), Expect = 7e-28 Identities = 64/117 (54%), Positives = 77/117 (65%) Frame = -2 Query: 351 SLVAATGIAYAFFSSPNSRPKPPYNHFSPKPNFYKPNFYKPHSLSLARKSPSKPYILACS 172 SL TGIA+ FSS SR + N+FSPKPNFYKP+ +L K+PSKPY L+CS Sbjct: 22 SLAVTTGIAFTLFSSRISRRRND-NYFSPKPNFYKPH-------NLTYKNPSKPYTLSCS 73 Query: 171 SKISPSPSPLTESTRPALIESIPPVPLNTIRLDLSESTRTVSTLVATAILVSKLFGH 1 S I+ S SPLTE TRP+ + P + R +ESTRTVSTLVAT IL+SKL GH Sbjct: 74 SNINSSTSPLTEPTRPSPEDQTRQNPSESTRQVFTESTRTVSTLVATVILLSKLLGH 130