BLASTX nr result
ID: Angelica27_contig00031573
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031573 (744 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017240176.1 PREDICTED: glycine-rich protein 5-like [Daucus ca... 80 2e-15 >XP_017240176.1 PREDICTED: glycine-rich protein 5-like [Daucus carota subsp. sativus] KZN03871.1 hypothetical protein DCAR_012627 [Daucus carota subsp. sativus] Length = 149 Score = 80.5 bits (197), Expect = 2e-15 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = -2 Query: 716 MAKWLSSFMLLFVALVANVHMTRAARDMPKNGLNDQKNVVNFGGLGSYS 570 MAKWLSSFMLLFVALVANV AARD+ K+GLNDQKNVVNFGGLGSYS Sbjct: 1 MAKWLSSFMLLFVALVANV----AARDIAKSGLNDQKNVVNFGGLGSYS 45