BLASTX nr result
ID: Angelica27_contig00031547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031547 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN08662.1 hypothetical protein DCAR_001192 [Daucus carota subsp... 59 5e-08 XP_017244126.1 PREDICTED: 30S ribosomal protein S1, chloroplasti... 59 5e-08 BAD95265.1 RIBOSOMAL PROTEIN [Arabidopsis thaliana] 56 5e-07 NP_001321757.1 Nucleic acid-binding proteins superfamily [Arabid... 56 6e-07 XP_013676393.1 PREDICTED: uncharacterized protein LOC106381078 i... 56 6e-07 AFX82591.1 plastid S1 binding domain protein precursor [Arabidop... 56 6e-07 XP_009105829.1 PREDICTED: uncharacterized protein LOC103831680 [... 56 6e-07 XP_013676392.1 PREDICTED: uncharacterized protein LOC106381078 i... 56 6e-07 CDX72821.1 BnaC06g32690D [Brassica napus] 56 6e-07 XP_013649497.1 PREDICTED: uncharacterized protein LOC106354165 [... 56 6e-07 XP_013591767.1 PREDICTED: 30S ribosomal protein S1 isoform X2 [B... 56 6e-07 XP_013591766.1 PREDICTED: 30S ribosomal protein S1 isoform X1 [B... 56 6e-07 XP_018458003.1 PREDICTED: uncharacterized protein LOC108828733 [... 56 6e-07 NP_177317.2 Nucleic acid-binding proteins superfamily [Arabidops... 56 6e-07 XP_006301141.1 hypothetical protein CARUB_v10021539mg [Capsella ... 56 6e-07 XP_010428003.1 PREDICTED: uncharacterized protein LOC104712739 i... 56 6e-07 XP_010471180.1 PREDICTED: uncharacterized protein LOC104751011 [... 56 6e-07 XP_006390750.1 hypothetical protein EUTSA_v10018428mg [Eutrema s... 56 6e-07 JAU87941.1 30S ribosomal protein S1, chloroplastic, partial [Noc... 56 6e-07 JAU29373.1 30S ribosomal protein S1, chloroplastic, partial [Noc... 56 6e-07 >KZN08662.1 hypothetical protein DCAR_001192 [Daucus carota subsp. sativus] Length = 500 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKLLGFKASI 190 V+GRTLSGKPLIS+RRYFRRLAWHRVR++ F I Sbjct: 208 VVGRTLSGKPLISSRRYFRRLAWHRVRQIKQFNEPI 243 >XP_017244126.1 PREDICTED: 30S ribosomal protein S1, chloroplastic [Daucus carota subsp. sativus] Length = 538 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKLLGFKASI 190 V+GRTLSGKPLIS+RRYFRRLAWHRVR++ F I Sbjct: 276 VVGRTLSGKPLISSRRYFRRLAWHRVRQIKQFNEPI 311 >BAD95265.1 RIBOSOMAL PROTEIN [Arabidopsis thaliana] Length = 336 Score = 55.8 bits (133), Expect = 5e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 251 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 279 >NP_001321757.1 Nucleic acid-binding proteins superfamily [Arabidopsis thaliana] ANM59394.1 Nucleic acid-binding proteins superfamily [Arabidopsis thaliana] Length = 429 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 251 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 279 >XP_013676393.1 PREDICTED: uncharacterized protein LOC106381078 isoform X2 [Brassica napus] Length = 486 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 238 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 266 >AFX82591.1 plastid S1 binding domain protein precursor [Arabidopsis thaliana] Length = 487 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 251 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 279 >XP_009105829.1 PREDICTED: uncharacterized protein LOC103831680 [Brassica rapa] Length = 488 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 238 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 266 >XP_013676392.1 PREDICTED: uncharacterized protein LOC106381078 isoform X1 [Brassica napus] Length = 489 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 238 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 266 >CDX72821.1 BnaC06g32690D [Brassica napus] Length = 490 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 239 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 267 >XP_013649497.1 PREDICTED: uncharacterized protein LOC106354165 [Brassica napus] CDX96339.1 BnaA07g29500D [Brassica napus] Length = 490 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 239 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 267 >XP_013591767.1 PREDICTED: 30S ribosomal protein S1 isoform X2 [Brassica oleracea var. oleracea] Length = 491 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 243 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 271 >XP_013591766.1 PREDICTED: 30S ribosomal protein S1 isoform X1 [Brassica oleracea var. oleracea] Length = 494 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 243 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 271 >XP_018458003.1 PREDICTED: uncharacterized protein LOC108828733 [Raphanus sativus] Length = 499 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 247 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 275 >NP_177317.2 Nucleic acid-binding proteins superfamily [Arabidopsis thaliana] AAF43225.1 Contains S1 RNA binding domain PF|00575. EST gb|AI997850 comes from this gene [Arabidopsis thaliana] AEE35223.1 Nucleic acid-binding proteins superfamily [Arabidopsis thaliana] OAP17234.1 RLSB [Arabidopsis thaliana] Length = 500 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 251 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 279 >XP_006301141.1 hypothetical protein CARUB_v10021539mg [Capsella rubella] EOA34039.1 hypothetical protein CARUB_v10021539mg [Capsella rubella] Length = 501 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 252 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 280 >XP_010428003.1 PREDICTED: uncharacterized protein LOC104712739 isoform X2 [Camelina sativa] Length = 504 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 255 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 283 >XP_010471180.1 PREDICTED: uncharacterized protein LOC104751011 [Camelina sativa] Length = 505 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 256 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 284 >XP_006390750.1 hypothetical protein EUTSA_v10018428mg [Eutrema salsugineum] ESQ28036.1 hypothetical protein EUTSA_v10018428mg [Eutrema salsugineum] Length = 505 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 256 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 284 >JAU87941.1 30S ribosomal protein S1, chloroplastic, partial [Noccaea caerulescens] Length = 510 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 261 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 289 >JAU29373.1 30S ribosomal protein S1, chloroplastic, partial [Noccaea caerulescens] Length = 510 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 297 VLGRTLSGKPLISARRYFRRLAWHRVRKL 211 VLGRTLSG+PL+S+RRYFRR+AWHRVR++ Sbjct: 261 VLGRTLSGRPLLSSRRYFRRIAWHRVRQI 289