BLASTX nr result
ID: Angelica27_contig00031532
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031532 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN01288.1 hypothetical protein DCAR_010042 [Daucus carota subsp... 53 2e-06 >KZN01288.1 hypothetical protein DCAR_010042 [Daucus carota subsp. sativus] Length = 188 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +3 Query: 117 MLSLPTHEHSNHVTTHPSQGKKRSACYIRNTK 212 M SLPTHEHSN +TT+PSQGK RS YI+ TK Sbjct: 1 MPSLPTHEHSNQITTYPSQGKNRSVVYIKKTK 32