BLASTX nr result
ID: Angelica27_contig00031371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031371 (229 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017234117.1 PREDICTED: abscisic acid 8'-hydroxylase 4-like is... 69 6e-12 XP_017234116.1 PREDICTED: abscisic acid 8'-hydroxylase 4-like is... 69 6e-12 >XP_017234117.1 PREDICTED: abscisic acid 8'-hydroxylase 4-like isoform X2 [Daucus carota subsp. sativus] Length = 432 Score = 68.9 bits (167), Expect = 6e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +2 Query: 113 MEFLCTGICITFFLCTLLLHYLIKKAKIEQRHKAKLPPG 229 MEFL TGI +TFFLCTLLL+YLIKKAKI Q+H+AKLPPG Sbjct: 1 MEFLGTGIYVTFFLCTLLLYYLIKKAKIGQKHEAKLPPG 39 >XP_017234116.1 PREDICTED: abscisic acid 8'-hydroxylase 4-like isoform X1 [Daucus carota subsp. sativus] Length = 482 Score = 68.9 bits (167), Expect = 6e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +2 Query: 113 MEFLCTGICITFFLCTLLLHYLIKKAKIEQRHKAKLPPG 229 MEFL TGI +TFFLCTLLL+YLIKKAKI Q+H+AKLPPG Sbjct: 1 MEFLGTGIYVTFFLCTLLLYYLIKKAKIGQKHEAKLPPG 39