BLASTX nr result
ID: Angelica27_contig00031325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031325 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT45276.1 Actin, partial [Anthurium amnicola] 65 3e-11 AAC32125.1 actin, partial [Picea mariana] 63 3e-11 AHA91825.1 actin-1, partial [Rosa hybrid cultivar] 64 5e-11 WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OI... 63 5e-11 ACJ83671.1 unknown [Medicago truncatula] 63 5e-11 JAU90273.1 Actin, partial [Noccaea caerulescens] 63 6e-11 EXL47609.1 actin, alpha skeletal muscle [Fusarium oxysporum f. s... 63 7e-11 AEG78680.1 actin, partial [Erythroxylum coca] 62 8e-11 JAU26149.1 Actin, partial [Noccaea caerulescens] 63 8e-11 AML60265.1 actin 4, partial [Morus alba] 62 8e-11 AAA30353.1 actin, partial [Bos taurus] 62 9e-11 XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphal... 64 9e-11 JAU98109.1 Actin [Noccaea caerulescens] 63 9e-11 AFK44654.1 unknown [Lotus japonicus] 63 9e-11 Q24733.1 RecName: Full=Actin AAA83551.1 actin, partial [Dictyoca... 62 9e-11 KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] 62 9e-11 CAR63709.1 putative beta actin isoform 1, partial [Angiostrongyl... 62 9e-11 AIX87807.1 cellular protein AbCp-73, partial [Androctonus bicolor] 62 9e-11 AFA36566.1 actin, partial [Lolium perenne] 62 1e-10 BAB60900.1 actin, partial [Ipomoea nil] 63 1e-10 >JAT45276.1 Actin, partial [Anthurium amnicola] Length = 100 Score = 64.7 bits (156), Expect = 3e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWITKAEYDESGP IVHRKCF Sbjct: 71 LASLSTFQQMWITKAEYDESGPAIVHRKCF 100 >AAC32125.1 actin, partial [Picea mariana] Length = 53 Score = 63.2 bits (152), Expect = 3e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI KAEYDESGP+IVHRKCF Sbjct: 24 LASLSTFQQMWIAKAEYDESGPSIVHRKCF 53 >AHA91825.1 actin-1, partial [Rosa hybrid cultivar] Length = 84 Score = 63.5 bits (153), Expect = 5e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+KAEYDESGP+IVHRKCF Sbjct: 55 LASLSTFQQMWISKAEYDESGPSIVHRKCF 84 >WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OIC63224.1 hypothetical protein A7L55_18690 [Acinetobacter baumannii] Length = 71 Score = 63.2 bits (152), Expect = 5e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI KAEYDESGP+IVHRKCF Sbjct: 42 LASLSTFQQMWIAKAEYDESGPSIVHRKCF 71 >ACJ83671.1 unknown [Medicago truncatula] Length = 71 Score = 63.2 bits (152), Expect = 5e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI KAEYDESGP+IVHRKCF Sbjct: 42 LASLSTFQQMWIAKAEYDESGPSIVHRKCF 71 >JAU90273.1 Actin, partial [Noccaea caerulescens] Length = 79 Score = 63.2 bits (152), Expect = 6e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI KAEYDESGP+IVHRKCF Sbjct: 50 LASLSTFQQMWIAKAEYDESGPSIVHRKCF 79 >EXL47609.1 actin, alpha skeletal muscle [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 71 Score = 62.8 bits (151), Expect = 7e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMW+TK EYDESGP+IVHRKCF Sbjct: 42 LASLSTFQQMWVTKQEYDESGPSIVHRKCF 71 >AEG78680.1 actin, partial [Erythroxylum coca] Length = 45 Score = 62.0 bits (149), Expect = 8e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+K EYDESGP+IVHRKCF Sbjct: 16 LASLSTFQQMWISKGEYDESGPSIVHRKCF 45 >JAU26149.1 Actin, partial [Noccaea caerulescens] Length = 90 Score = 63.2 bits (152), Expect = 8e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI KAEYDESGP+IVHRKCF Sbjct: 61 LASLSTFQQMWIAKAEYDESGPSIVHRKCF 90 >AML60265.1 actin 4, partial [Morus alba] Length = 47 Score = 62.0 bits (149), Expect = 8e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+K EYDESGP+IVHRKCF Sbjct: 18 LASLSTFQQMWISKGEYDESGPSIVHRKCF 47 >AAA30353.1 actin, partial [Bos taurus] Length = 31 Score = 61.6 bits (148), Expect = 9e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+K EYDESGP+IVHRKCF Sbjct: 2 LASLSTFQQMWISKQEYDESGPSIVHRKCF 31 >XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphalaria glabrata] Length = 107 Score = 63.5 bits (153), Expect = 9e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+KAEYDESGP+IVHRKCF Sbjct: 78 LASLSTFQQMWISKAEYDESGPSIVHRKCF 107 >JAU98109.1 Actin [Noccaea caerulescens] Length = 93 Score = 63.2 bits (152), Expect = 9e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI KAEYDESGP+IVHRKCF Sbjct: 64 LASLSTFQQMWIAKAEYDESGPSIVHRKCF 93 >AFK44654.1 unknown [Lotus japonicus] Length = 93 Score = 63.2 bits (152), Expect = 9e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMW+TKAEYDESGP+IVH+KCF Sbjct: 64 LASLSTFQQMWVTKAEYDESGPSIVHQKCF 93 >Q24733.1 RecName: Full=Actin AAA83551.1 actin, partial [Dictyocaulus viviparus] Length = 33 Score = 61.6 bits (148), Expect = 9e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+K EYDESGP+IVHRKCF Sbjct: 4 LASLSTFQQMWISKQEYDESGPSIVHRKCF 33 >KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] Length = 51 Score = 62.0 bits (149), Expect = 9e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+K EYDESGP+IVHRKCF Sbjct: 22 LASLSTFQQMWISKGEYDESGPSIVHRKCF 51 >CAR63709.1 putative beta actin isoform 1, partial [Angiostrongylus cantonensis] Length = 36 Score = 61.6 bits (148), Expect = 9e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+K EYDESGP+IVHRKCF Sbjct: 7 LASLSTFQQMWISKQEYDESGPSIVHRKCF 36 >AIX87807.1 cellular protein AbCp-73, partial [Androctonus bicolor] Length = 37 Score = 61.6 bits (148), Expect = 9e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+K EYDESGP+IVHRKCF Sbjct: 8 LASLSTFQQMWISKQEYDESGPSIVHRKCF 37 >AFA36566.1 actin, partial [Lolium perenne] Length = 38 Score = 61.6 bits (148), Expect = 1e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI+K EYDESGP IVHRKCF Sbjct: 9 LASLSTFQQMWISKGEYDESGPAIVHRKCF 38 >BAB60900.1 actin, partial [Ipomoea nil] Length = 100 Score = 63.2 bits (152), Expect = 1e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 344 LASLSTFQQMWITKAEYDESGPTIVHRKCF 255 LASLSTFQQMWI KAEYDESGP+IVHRKCF Sbjct: 71 LASLSTFQQMWIAKAEYDESGPSIVHRKCF 100