BLASTX nr result
ID: Angelica27_contig00031312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031312 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017216917.1 PREDICTED: tyrosine-specific transport protein-li... 82 2e-16 >XP_017216917.1 PREDICTED: tyrosine-specific transport protein-like isoform X1 [Daucus carota subsp. sativus] XP_017216918.1 PREDICTED: tyrosine-specific transport protein-like isoform X1 [Daucus carota subsp. sativus] XP_017216919.1 PREDICTED: tyrosine-specific transport protein-like isoform X1 [Daucus carota subsp. sativus] Length = 484 Score = 82.0 bits (201), Expect = 2e-16 Identities = 45/75 (60%), Positives = 51/75 (68%) Frame = +1 Query: 28 LAISTRKHSVSPIHXXXXXXXXXXFLCLDGCTSKSKIMGFKCFSAKQDVDDDFEMDYRLF 207 L+ STR+H VS F+ L+GC+S SK M FKCFSAKQD DD MDYRLF Sbjct: 27 LSFSTRQHIVSSF---TTSGGQARFIWLNGCSSTSKFMAFKCFSAKQDQDD---MDYRLF 80 Query: 208 SNLNQSTFKREPGSI 252 SNLNQSTF R+PGSI Sbjct: 81 SNLNQSTFTRDPGSI 95