BLASTX nr result
ID: Angelica27_contig00031154
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00031154 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243387.1 PREDICTED: subtilisin-like protease SBT1.3 [Daucu... 65 7e-10 XP_017258006.1 PREDICTED: subtilisin-like protease SBT1.3 [Daucu... 64 2e-09 KZM92424.1 hypothetical protein DCAR_020211 [Daucus carota subsp... 64 2e-09 XP_002321861.2 subtilase family protein [Populus trichocarpa] EE... 56 1e-06 XP_011041660.1 PREDICTED: subtilisin-like protease [Populus euph... 55 2e-06 >XP_017243387.1 PREDICTED: subtilisin-like protease SBT1.3 [Daucus carota subsp. sativus] KZN00659.1 hypothetical protein DCAR_009413 [Daucus carota subsp. sativus] Length = 775 Score = 65.1 bits (157), Expect = 7e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +3 Query: 228 MVVKWVLFLLLSYLTISNVVSLTTIPTTKTYIVQIDRSAKPE 353 MVVKWV LLL+ LTI+NVVSLT P TKTYIVQIDR AKPE Sbjct: 1 MVVKWVFLLLLASLTITNVVSLTASPFTKTYIVQIDRLAKPE 42 >XP_017258006.1 PREDICTED: subtilisin-like protease SBT1.3 [Daucus carota subsp. sativus] Length = 770 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 228 MVVKWVLFLLLSYLTISNVVSLTTIPTTKTYIVQIDRSAKPE 353 MVV+W FLL +YL I+NV+S T IPT+KTYIVQI+RSAKPE Sbjct: 1 MVVRWAFFLLPTYLAITNVLSSTKIPTSKTYIVQINRSAKPE 42 >KZM92424.1 hypothetical protein DCAR_020211 [Daucus carota subsp. sativus] Length = 1044 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 228 MVVKWVLFLLLSYLTISNVVSLTTIPTTKTYIVQIDRSAKPE 353 MVV+W FLL +YL I+NV+S T IPT+KTYIVQI+RSAKPE Sbjct: 1 MVVRWAFFLLPTYLAITNVLSSTKIPTSKTYIVQINRSAKPE 42 >XP_002321861.2 subtilase family protein [Populus trichocarpa] EEF05988.2 subtilase family protein [Populus trichocarpa] Length = 778 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +3 Query: 234 VKWVLFLLLSYLTISNVVSLTTIPTTKTYIVQIDRSAKPE 353 VKW+ F+L SYL ++ VVS+ T+ T KTYIVQ+D+SAKPE Sbjct: 6 VKWLFFILTSYLALNVVVSMNTLLTRKTYIVQMDKSAKPE 45 >XP_011041660.1 PREDICTED: subtilisin-like protease [Populus euphratica] Length = 778 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +3 Query: 234 VKWVLFLLLSYLTISNVVSLTTIPTTKTYIVQIDRSAKPE 353 VKW+ F+L SYL ++ V+S+ T+ T KTYIVQ+D+SAKPE Sbjct: 6 VKWLFFILTSYLALNVVISMNTLLTRKTYIVQMDKSAKPE 45